| Clone Name | rbast25g07 |
|---|---|
| Clone Library Name | barley_pub |
>CLS1_BACSU (P45860) Probable cardiolipin synthetase 1 (EC 2.7.8.-)| (Cardiolipin synthase 1) (CL synthase 1) Length = 500 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = -1 Query: 119 GVDLVPVSPLKYSGFS*ELGF 57 GVD+VP SPLKY F+ +L F Sbjct: 219 GVDIVPFSPLKYGFFNQKLNF 239
>PSAA_PROMA (Q9L4N4) Photosystem I P700 chlorophyll a apoprotein A1 (PsaA)| Length = 773 Score = 29.3 bits (64), Expect = 2.6 Identities = 18/59 (30%), Positives = 26/59 (44%) Frame = -1 Query: 299 PRVSGDAARGGAPSVYPYRQDEDHLFLNL**ASAM*FWSHMCLL*SR*RIGLPLFTWLW 123 P G+ A+G AP+ Y D DH ++ + FWS S+ G TW+W Sbjct: 5 PPERGEKAKGAAPTPYDQPVDRDHAPIDYEKLNKPGFWS------SKLSKGPKTTTWIW 57
>XYLT1_MOUSE (Q811B1) Xylosyltransferase 1 (EC 2.4.2.26) (Xylosyltransferase I)| (Peptide O-xylosyltransferase 1) Length = 953 Score = 28.1 bits (61), Expect = 5.8 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +3 Query: 42 VTLNTKP-QFSTEP*ILERTDRNQVNTIPKPGKQ-R*SNSSTRLQKTHMTPEL 194 +TL T+ FS P RTD N N++PK + SN + R QK PEL Sbjct: 122 ITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPEL 174
>XYLT1_HUMAN (Q86Y38) Xylosyltransferase 1 (EC 2.4.2.26) (Xylosyltransferase I)| (XylT-I) (XT-I) (Peptide O-xylosyltransferase 1) Length = 959 Score = 28.1 bits (61), Expect = 5.8 Identities = 21/53 (39%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = +3 Query: 42 VTLNTKP-QFSTEP*ILERTDRNQVNTIPKPGKQ-R*SNSSTRLQKTHMTPEL 194 +TL T+ FS P RTD N N++PK + SN + R QK PEL Sbjct: 129 ITLETQDGYFSHRPKEKVRTDSNNENSVPKDFENVDNSNFAPRTQKQKHQPEL 181
>AXN2_BRARE (P57095) Axin-2 (Axis inhibition protein 2)| Length = 812 Score = 27.7 bits (60), Expect = 7.5 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 102 RNQVNTIPKPGKQR*SNSSTRLQKTHMTP 188 R ++ + KP KQR S SS + K+H P Sbjct: 675 RRRLEEVSKPSKQRHSTSSLQRDKSHPVP 703
>BEDB_PSEPU (Q07947) Benzene 1,2-dioxygenase system ferredoxin subunit| Length = 107 Score = 27.3 bits (59), Expect = 9.9 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -2 Query: 316 PECDTVPVYPEMLHGEELHLCIRIGKTK 233 P C + VYP + G+E+H+ + G+ K Sbjct: 80 PACKPIKVYPIKIEGDEVHVDLDNGELK 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,069,500 Number of Sequences: 219361 Number of extensions: 955806 Number of successful extensions: 2410 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2410 length of database: 80,573,946 effective HSP length: 82 effective length of database: 62,586,344 effective search space used: 1502072256 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)