| Clone Name | rbast24e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | IDD_HUMAN (P98153) Integral membrane protein DGCR2/IDD precursor | 28 | 9.1 |
|---|
>IDD_HUMAN (P98153) Integral membrane protein DGCR2/IDD precursor| Length = 550 Score = 27.7 bits (60), Expect = 9.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = -1 Query: 104 NHSSLACSSRPLEFIRLPFSISPWRLATCKDQSN 3 N AC S ++ I LP+ W ATC+D+S+ Sbjct: 31 NPGQFACRSGTIQCIPLPWQCDGW--ATCEDESD 62 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,584,471 Number of Sequences: 219361 Number of extensions: 260071 Number of successful extensions: 752 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 747 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 752 length of database: 80,573,946 effective HSP length: 24 effective length of database: 75,309,282 effective search space used: 1807422768 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)