| Clone Name | rbast24c10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUKC_MESVI (Q9MUR0) NAD(P)H-quinone oxidoreductase chain K, chlo... | 30 | 2.4 | 2 | ALDH2_BACSU (P39616) Probable aldehyde dehydrogenase ywdH (EC 1.... | 29 | 4.1 | 3 | BCOR_MOUSE (Q8CGN4) BCoR protein (BCL-6 corepressor) | 28 | 5.3 | 4 | ATG3_EMENI (Q5AVG2) Autophagy-related protein 3 (Autophagy-relat... | 28 | 7.0 | 5 | UL16_VZVD (P09293) Gene 44 protein | 28 | 7.0 | 6 | RECR_LACLA (Q9CIL6) Recombination protein recR | 28 | 7.0 | 7 | RECR_DEIRA (Q9ZNA2) Recombination protein recR | 28 | 7.0 |
|---|
>NUKC_MESVI (Q9MUR0) NAD(P)H-quinone oxidoreductase chain K, chloroplast (EC| 1.6.5.-) (NAD(P)H dehydrogenase, chain K) (NADH-plastoquinone oxidoreductase subunit K) Length = 247 Score = 29.6 bits (65), Expect = 2.4 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +2 Query: 41 IYHPLHFTLSPLTGPYLSYSTIQTPPSSLSPA 136 I H L + TG YL+ S QTPP SLS A Sbjct: 198 IKHELTLSSPVYTGKYLNSSARQTPPRSLSEA 229
>ALDH2_BACSU (P39616) Probable aldehyde dehydrogenase ywdH (EC 1.2.1.3)| Length = 457 Score = 28.9 bits (63), Expect = 4.1 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 47 HPLHFTLSPLTGPYLSYSTIQTPPSSLSPAV 139 +PL LSPL G + +T+ PS +PAV Sbjct: 117 YPLQLALSPLIGAIAAGNTVVLKPSEYTPAV 147
>BCOR_MOUSE (Q8CGN4) BCoR protein (BCL-6 corepressor)| Length = 1759 Score = 28.5 bits (62), Expect = 5.3 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = +3 Query: 6 TRSERDKEQTEESTTRSISHYPPSLVLIYHTVQYRRPHLPYPR 134 T S+ K E S S + PP+ + + +R P +PYPR Sbjct: 614 TSSKGAKANPEPSFKASENGLPPTSIFLSPNEAFRSPAIPYPR 656
>ATG3_EMENI (Q5AVG2) Autophagy-related protein 3 (Autophagy-related E2-like| conjugation enzyme atg3) Length = 787 Score = 28.1 bits (61), Expect = 7.0 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = +1 Query: 25 RSKQRNLPPAPFHIIPPHWSLFIIQYNTDAP 117 R K +++P +PF ++PP L I Y D P Sbjct: 515 RFKLQSMPESPFLLLPPELRLQIYSYVLDIP 545
>UL16_VZVD (P09293) Gene 44 protein| Length = 363 Score = 28.1 bits (61), Expect = 7.0 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = +1 Query: 19 VTRSKQRNLPPAPFHII 69 +TR +Q NLPP FH+I Sbjct: 82 ITRPRQMNLPPKTFHVI 98
>RECR_LACLA (Q9CIL6) Recombination protein recR| Length = 198 Score = 28.1 bits (61), Expect = 7.0 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = +2 Query: 35 RGIYHPLHFTLSPLTG 82 RG+YH LH T+SP+ G Sbjct: 101 RGLYHVLHGTISPMNG 116
>RECR_DEIRA (Q9ZNA2) Recombination protein recR| Length = 220 Score = 28.1 bits (61), Expect = 7.0 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = +2 Query: 26 GANRGIYHPLHFTLSPLTG 82 G RG+YH LH LSP+ G Sbjct: 98 GEYRGLYHVLHGVLSPMNG 116 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,812,940 Number of Sequences: 219361 Number of extensions: 366837 Number of successful extensions: 1205 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1191 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1204 length of database: 80,573,946 effective HSP length: 23 effective length of database: 75,528,643 effective search space used: 1812687432 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)