| Clone Name | rbast24a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NEO1_CHICK (Q90610) Neogenin (Fragment) | 29 | 2.6 | 2 | MIP1_SCHPO (P87141) WD-repeat protein mip1 | 28 | 7.7 | 3 | COS6_YEAST (P53344) Protein COS6 | 28 | 7.7 | 4 | DXS_RALSO (Q8XX95) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2... | 27 | 10.0 |
|---|
>NEO1_CHICK (Q90610) Neogenin (Fragment)| Length = 1443 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/50 (30%), Positives = 30/50 (60%) Frame = +2 Query: 65 VGVGPNSGCPIGGSRAPCGIYSSPICTKDYFLVVLLFLKIMNIISLDLAA 214 V VGP+ P+ GS +P G +SP+ + LV+++ + ++ I+ + + A Sbjct: 1061 VDVGPDYKPPLSGSNSPHGSPTSPL-DSNMLLVIIVSVGVITIVIVVIVA 1109
>MIP1_SCHPO (P87141) WD-repeat protein mip1| Length = 1313 Score = 27.7 bits (60), Expect = 7.7 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +1 Query: 85 WVSDRRIPSPVWNLQLTHLHKRLFSRRIIILEDYEHYLVGSRGLL--SPPQRGSGGAHHT 258 W+ + WN+ HL +RLF + +++ + ++L+ R +L S + S T Sbjct: 367 WIFTAITDTIAWNVFPKHLFRRLFRQDLMVAALFRNFLLAERIMLVHSCHPQSSPELPPT 426 Query: 259 SDDLYLYTWKLA 294 D +W LA Sbjct: 427 HDHPMWNSWDLA 438
>COS6_YEAST (P53344) Protein COS6| Length = 381 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/37 (32%), Positives = 23/37 (62%) Frame = +1 Query: 67 RSRSQLWVSDRRIPSPVWNLQLTHLHKRLFSRRIIIL 177 +S S + + D ++P + +LT + KR+F+RR + L Sbjct: 205 KSWSPVGLEDAKLPKEAYRFKLTWVLKRIFNRRCLPL 241
>DXS_RALSO (Q8XX95) 1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)| (1-deoxyxylulose-5-phosphate synthase) (DXP synthase) (DXPS) Length = 636 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +3 Query: 219 LPTPERVRRRASHIGRPVFVHV 284 +PT + +R+RA GRP F+HV Sbjct: 259 VPTLQNIRQRALEGGRPQFLHV 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,084,445 Number of Sequences: 219361 Number of extensions: 1039437 Number of successful extensions: 2866 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2810 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2866 length of database: 80,573,946 effective HSP length: 78 effective length of database: 63,463,788 effective search space used: 1523130912 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)