| Clone Name | rbast23d05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUTS_ENTFA (Q82ZA2) DNA mismatch repair protein mutS | 31 | 1.0 | 2 | PEPA4_MACFU (P27678) Pepsin A-4 precursor (EC 3.4.23.1) (Pepsin ... | 28 | 5.0 | 3 | PRIM_MYCGE (P47492) DNA primase (EC 2.7.7.-) | 28 | 6.5 | 4 | MUTS_LACSS (Q38YR4) DNA mismatch repair protein mutS | 28 | 8.5 |
|---|
>MUTS_ENTFA (Q82ZA2) DNA mismatch repair protein mutS| Length = 858 Score = 30.8 bits (68), Expect = 1.0 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 71 PNELPNAPSTAYKESQHPILKNILG*QGYLPYSIQ 175 P N + A E +HP+++ +LG Q Y+P SI+ Sbjct: 563 PTLRSNTKNLAIVEGRHPVVEKVLGHQEYIPNSIR 597
>PEPA4_MACFU (P27678) Pepsin A-4 precursor (EC 3.4.23.1) (Pepsin I/II)| Length = 388 Score = 28.5 bits (62), Expect = 5.0 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = +1 Query: 142 GVAGL--PSILDSGSKAFFDNLWQNR 213 G+ GL PSI SG+ FDN+W R Sbjct: 181 GILGLAYPSISSSGATPVFDNIWNQR 206
>PRIM_MYCGE (P47492) DNA primase (EC 2.7.7.-)| Length = 607 Score = 28.1 bits (61), Expect = 6.5 Identities = 15/41 (36%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +2 Query: 23 FDNNTDYCNVHRHAKLPNELPNAPS----TAYKESQHPILK 133 FDNN Y N HA+ P EL + TA++E+ + + K Sbjct: 449 FDNNRFYINTSGHAQPPQELQKTTAALVQTAFEEAVNELWK 489
>MUTS_LACSS (Q38YR4) DNA mismatch repair protein mutS| Length = 867 Score = 27.7 bits (60), Expect = 8.5 Identities = 9/25 (36%), Positives = 18/25 (72%) Frame = +2 Query: 110 ESQHPILKNILG*QGYLPYSIQAQK 184 + +HP+++ +LG Q Y+P ++Q K Sbjct: 576 DGRHPVVEKVLGRQKYIPNAVQMGK 600 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,152,790 Number of Sequences: 219361 Number of extensions: 613394 Number of successful extensions: 1684 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1684 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)