ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast23b03 |
|---|---|
| Clone Library Name | barley_pub |
>FRI1_MAIZE (P29036) Ferritin-1, chloroplast precursor (EC 1.16.3.1) (ZmFer1)| Length = 254 Score = 41.2 bits (95), Expect = 7e-04 Identities = 18/20 (90%), Positives = 18/20 (90%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEEVA 181 RVGKG GVWHFDQMLLEE A Sbjct: 235 RVGKGHGVWHFDQMLLEEEA 254
>FRI2_TOBAC (Q8H1T3) Ferritin-2, chloroplast precursor (EC 1.16.3.1) (NtFer2)| Length = 259 Score = 39.3 bits (90), Expect = 0.003 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEE 187 RVGKG GVWHFDQMLL+E Sbjct: 237 RVGKGHGVWHFDQMLLQE 254
>FRI3_SOYBN (Q948P6) Ferritin-3, chloroplast precursor (EC 1.16.3.1) (SFerH-3)| Length = 256 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEE 187 RVGKG GVWHFDQMLL E Sbjct: 234 RVGKGHGVWHFDQMLLHE 251
>FRI2_VIGUN (Q41709) Ferritin-2, chloroplast precursor (EC 1.16.3.1)| Length = 250 Score = 38.5 bits (88), Expect = 0.005 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEE 187 RVGKG GVWHFDQMLL E Sbjct: 228 RVGKGHGVWHFDQMLLHE 245
>FRI2_ARATH (Q9SRL5) Ferritin-2, chloroplast precursor (EC 1.16.3.1)| Length = 253 Score = 37.0 bits (84), Expect = 0.014 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEE 187 R+GKG GVWHFDQMLL + Sbjct: 234 RIGKGHGVWHFDQMLLND 251
>FRI2_MAIZE (P29390) Ferritin-2, chloroplast precursor (EC 1.16.3.1) (ZmFer2)| Length = 252 Score = 36.2 bits (82), Expect = 0.023 Identities = 17/21 (80%), Positives = 18/21 (85%), Gaps = 1/21 (4%) Frame = -3 Query: 240 RVG-KGPGVWHFDQMLLEEVA 181 RVG KG GVWHFDQMLL+E A Sbjct: 232 RVGNKGHGVWHFDQMLLQEAA 252
>FRI_MALXI (Q94FY2) Ferritin, chloroplast precursor (EC 1.16.3.1) (Apf1)| Length = 250 Score = 35.0 bits (79), Expect = 0.052 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLE 190 RVGKG GVWHFDQ LL+ Sbjct: 234 RVGKGHGVWHFDQRLLD 250
>FRI1_SOYBN (P19976) Ferritin-1, chloroplast precursor (EC 1.16.3.1) (SOF-35)| (SFerH-1) Length = 250 Score = 35.0 bits (79), Expect = 0.052 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLE 190 RVGKG GVWHFDQ LL+ Sbjct: 234 RVGKGHGVWHFDQRLLD 250
>FRI4_ARATH (Q9S756) Ferritin-4, chloroplast precursor (EC 1.16.3.1)| Length = 259 Score = 35.0 bits (79), Expect = 0.052 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLE 190 RVGKG G WHF+QMLLE Sbjct: 242 RVGKGHGTWHFNQMLLE 258
>FRI1_PEA (P19975) Ferritin-1, chloroplast precursor (EC 1.16.3.1)| Length = 253 Score = 35.0 bits (79), Expect = 0.052 Identities = 15/19 (78%), Positives = 15/19 (78%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEEV 184 RVGKG GVWHFDQ LL V Sbjct: 232 RVGKGHGVWHFDQRLLHGV 250
>FRI1_BRANA (Q96540) Ferritin-1, chloroplast precursor (EC 1.16.3.1)| Length = 254 Score = 34.7 bits (78), Expect = 0.067 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -3 Query: 237 VGKGPGVWHFDQMLL 193 VGKG GVWHFDQMLL Sbjct: 239 VGKGHGVWHFDQMLL 253
>FRI1_TOBAC (Q8RX97) Ferritin-1, chloroplast precursor (EC 1.16.3.1) (NtFer1)| Length = 251 Score = 34.3 bits (77), Expect = 0.088 Identities = 15/20 (75%), Positives = 16/20 (80%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEEVA 181 RVG+G GVW FDQMLL E A Sbjct: 230 RVGQGHGVWQFDQMLLNEGA 249
>FRI1_ARATH (Q39101) Ferritin-1, chloroplast precursor (EC 1.16.3.1) (AtFer1)| Length = 255 Score = 34.3 bits (77), Expect = 0.088 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -3 Query: 237 VGKGPGVWHFDQMLL 193 +GKG GVWHFDQMLL Sbjct: 240 IGKGHGVWHFDQMLL 254
>FRI2_SOYBN (Q94IC4) Ferritin-2, chloroplast precursor (EC 1.16.3.1) (SFerH-2)| Length = 257 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 237 VGKGPGVWHFDQMLLEE 187 VGKG GVWHFDQ LL + Sbjct: 237 VGKGHGVWHFDQKLLHD 253
>FRI3_VIGUN (O65100) Ferritin-3, chloroplast precursor (EC 1.16.3.1)| Length = 256 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 237 VGKGPGVWHFDQMLLEE 187 VGKG GVWHFDQ LL + Sbjct: 240 VGKGHGVWHFDQRLLHD 256
>FRI_PHAVU (P25699) Ferritin, chloroplast precursor (EC 1.16.3.1)| Length = 254 Score = 33.1 bits (74), Expect = 0.20 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 237 VGKGPGVWHFDQMLLEE 187 VGKG GVWHFDQ LL + Sbjct: 234 VGKGHGVWHFDQSLLHD 250
>AOX_EMENI (Q9P959) Alternative oxidase, mitochondrial precursor (EC 1.-.-.-)| Length = 354 Score = 33.1 bits (74), Expect = 0.20 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = +2 Query: 59 IAPYKPDWKNPPKPHPGVGLSPL 127 + P+ +WK+P KPHPG G+ L Sbjct: 321 VNPFAVEWKDPSKPHPGKGIKHL 343
>FRI3_ARATH (Q9LYN2) Ferritin-3, chloroplast precursor (EC 1.16.3.1)| Length = 259 Score = 31.6 bits (70), Expect = 0.57 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -3 Query: 240 RVGKGPGVWHFDQMLLEEVA 181 R+GKG G WHFDQ LL A Sbjct: 240 RLGKGHGTWHFDQELLGAAA 259
>FRI4_SOYBN (Q948P5) Ferritin-4, chloroplast precursor (EC 1.16.3.1) (SFerH-4)| Length = 247 Score = 31.2 bits (69), Expect = 0.74 Identities = 12/15 (80%), Positives = 13/15 (86%) Frame = -3 Query: 231 KGPGVWHFDQMLLEE 187 +G GVWHFDQMLL E Sbjct: 228 QGHGVWHFDQMLLHE 242
>PVDR_PLAVS (P22290) Duffy receptor precursor (Erythrocyte-binding protein)| Length = 1070 Score = 30.4 bits (67), Expect = 1.3 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = -1 Query: 194 LRRWLEGHNDGRARENVGVKCQVVEISQRLDVVLGDFSS 78 L RWL+G N+ R+ EN+ K V E+ + + G SS Sbjct: 60 LERWLQGTNERRSEENIKYKYGVTELKIKYAQMNGKRSS 98
>Y539_PASMU (Q9CN96) UPF0260 protein PM0539| Length = 148 Score = 28.5 bits (62), Expect = 4.8 Identities = 13/42 (30%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 239 EW-AKAPECGTSIKCCLRRWLEGHNDGRARENVGVKCQVVEI 117 EW A CG KCC R+++EGH + + C ++++ Sbjct: 22 EWEALCDGCG---KCCYRKFIEGHGKRKKLYYTRIACNLLDL 60
>JAK1_CYPCA (Q09178) Tyrosine-protein kinase Jak1 (EC 2.7.10.2) (Janus kinase| 1) (Jak-1) Length = 1156 Score = 27.7 bits (60), Expect = 8.2 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 32 FYFKSQHNSIAPYKPDWKNPPKPHPGVGLSP 124 FYF + H + P W++ H GV +SP Sbjct: 110 FYFTNWHAPVRTESPVWRHSLFKHKGVSVSP 140
>RGF2_SCHPO (Q9UTR5) Rho1 guanine nucleotide exchange factor 2| Length = 1158 Score = 27.7 bits (60), Expect = 8.2 Identities = 12/33 (36%), Positives = 15/33 (45%) Frame = -2 Query: 136 NVK*WR*ANAWMWFWGIFPVGFVGCYAVVLGFE 38 N W+ +WM W P G CY +L FE Sbjct: 1055 NTNGWKSRQSWMINWEGQPQGCALCYPYILAFE 1087 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,236,188 Number of Sequences: 219361 Number of extensions: 781857 Number of successful extensions: 2128 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 2071 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2127 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
