| Clone Name | rbast21e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y917_PYRAB (Q9V074) UPF0130 protein PYRAB09170 | 30 | 2.1 | 2 | Y175_PYRKO (Q5JFK6) UPF0130 protein TK0175 | 28 | 4.8 | 3 | NSP1_MEDTR (Q4VYC8) Nodulation signaling pathway 1 protein | 28 | 6.2 | 4 | MARK1_MOUSE (Q8VHJ5) Serine/threonine-protein kinase MARK1 (EC 2... | 28 | 8.1 | 5 | MARK1_RAT (O08678) Serine/threonine-protein kinase MARK1 (EC 2.7... | 28 | 8.1 |
|---|
>Y917_PYRAB (Q9V074) UPF0130 protein PYRAB09170| Length = 194 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 253 GRPWRITRSPAMEVGGRTLIDG 188 G+ W + RSP + VG RTL DG Sbjct: 93 GQLWLLVRSPILHVGARTLEDG 114
>Y175_PYRKO (Q5JFK6) UPF0130 protein TK0175| Length = 198 Score = 28.5 bits (62), Expect = 4.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 256 SGRPWRITRSPAMEVGGRTLID 191 SG+ W + RSP + VG RTL D Sbjct: 93 SGQLWFLVRSPILHVGARTLED 114
>NSP1_MEDTR (Q4VYC8) Nodulation signaling pathway 1 protein| Length = 554 Score = 28.1 bits (61), Expect = 6.2 Identities = 19/68 (27%), Positives = 27/68 (39%) Frame = +1 Query: 10 YLNTEYNHRXXXXXXXWNWNTGIENQSMCTCMHAKTRSFNAVSSKFNEKKYGATTCVRGS 189 +L+ YN+ WN N I NQ + A T S NA +S N TT Sbjct: 26 FLDDPYNNGYIHEYEIWNQNQDISNQYQ---IDANTNSSNATNSTTNIVAASTTTSTTSL 82 Query: 190 RRSRFYHL 213 + F ++ Sbjct: 83 EPNSFNNI 90
>MARK1_MOUSE (Q8VHJ5) Serine/threonine-protein kinase MARK1 (EC 2.7.11.1)| (MAP/microtubule affinity-regulating kinase 1) (ELKL motif serine/threonine-protein kinase 3) Length = 795 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -1 Query: 248 SMADHSLPGDGSRW*NLDRRLPRTHVVAPYFFSLNLEETALKLLVL 111 ++ SLP DG L R+ R P++ S + E KLLVL Sbjct: 249 TLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCENLLKKLLVL 294
>MARK1_RAT (O08678) Serine/threonine-protein kinase MARK1 (EC 2.7.11.1)| (MAP/microtubule affinity-regulating kinase 1) Length = 793 Score = 27.7 bits (60), Expect = 8.1 Identities = 16/46 (34%), Positives = 22/46 (47%) Frame = -1 Query: 248 SMADHSLPGDGSRW*NLDRRLPRTHVVAPYFFSLNLEETALKLLVL 111 ++ SLP DG L R+ R P++ S + E KLLVL Sbjct: 249 TLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCENLLKKLLVL 294 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,317,289 Number of Sequences: 219361 Number of extensions: 685920 Number of successful extensions: 1767 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1741 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1767 length of database: 80,573,946 effective HSP length: 61 effective length of database: 67,192,925 effective search space used: 1612630200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)