ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast21e04 |
|---|---|
| Clone Library Name | barley_pub |
>RPOA_SHFV (Q68772) Replicase polyprotein 1ab (ORF1ab polyprotein) [Includes:| Replicase polyprotein 1a (ORF1a)] [Contains: Nsp1-alpha papain-like cysteine proteinase (EC 3.4.22.-) (PCP1-alpha); Nsp1-beta papain-like cysteine proteinase (EC 3.4.22.-) (PCP1 Length = 3596 Score = 38.9 bits (89), Expect = 0.003 Identities = 23/62 (37%), Positives = 32/62 (51%), Gaps = 2/62 (3%) Frame = -2 Query: 186 LLRCYFVLNVARSFCFRTIPMVIYCYLLKFIC--SAK*LFLLCCYWIVSYFVLIF*DPIG 13 LL CYF + VA F F P+ I C +L + SA+ +LCC +V Y +F D I Sbjct: 911 LLGCYFSMAVAMFFLFLGSPLFILCAVLAGVIAPSARYPKILCCCLVVVYICTLFADAIS 970 Query: 12 RI 7 + Sbjct: 971 SV 972
>R1AB_CVM2 (Q9PYA3) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase ( Length = 7124 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 219 LPTYILHRSEFLLRCYFVLNVARSFCFRTIPMVIYCYLLKFI 94 +PTY +H+S+ L Y V + R + + C+ KFI Sbjct: 2808 MPTYAVHKSDMQLPLYASFKVIDNGVLRDVTVTDACFANKFI 2849
>R1AB_CVBQ (Q8V6W7) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase ( Length = 7059 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 219 LPTYILHRSEFLLRCYFVLNVARSFCFRTIPMVIYCYLLKF 97 +PTY +H+S+F L Y V + R + + C+ KF Sbjct: 2775 MPTYTVHKSDFQLPVYASYKVLDNGVIRDVSVEDVCFANKF 2815
>R1AB_CVBM (Q66198) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase ( Length = 7094 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 219 LPTYILHRSEFLLRCYFVLNVARSFCFRTIPMVIYCYLLKF 97 +PTY +H+S+F L Y V + R + + C+ KF Sbjct: 2775 MPTYTVHKSDFQLPVYASYKVLDNGVIRDVSVEDVCFANKF 2815
>R1AB_CVBLU (Q8V439) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase Length = 7094 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 219 LPTYILHRSEFLLRCYFVLNVARSFCFRTIPMVIYCYLLKF 97 +PTY +H+S+F L Y V + R + + C+ KF Sbjct: 2775 MPTYTVHKSDFQLPVYTSYKVLDNGVIRDVSVEDVCFANKF 2815
>R1AB_CVBEN (Q91A29) Replicase polyprotein 1ab (pp1ab) (ORF1ab polyprotein)| [Includes: Replicase polyprotein 1a (pp1a) (ORF1a)] [Contains: p28; p65; p210 (EC 3.4.22.-) (Papain-like proteinases 1/2) (PL1-PRO/PL2-PRO); Peptide HD2 (p44); 3C-like proteinase Length = 7094 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/41 (31%), Positives = 21/41 (51%) Frame = -2 Query: 219 LPTYILHRSEFLLRCYFVLNVARSFCFRTIPMVIYCYLLKF 97 +PTY +H+S+F L Y V + R + + C+ KF Sbjct: 2775 MPTYTVHKSDFQLPVYASYKVLDNGVIRDVSVEDVCFANKF 2815
>UCRI4_TOBAC (P51134) Ubiquinol-cytochrome c reductase iron-sulfur subunit 4,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 4) (RISP4) Length = 236 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 279 TYSFLEDNKMLIG 241 TYSFLE+NK+LIG Sbjct: 224 TYSFLEENKLLIG 236
>UCRI2_TOBAC (P51132) Ubiquinol-cytochrome c reductase iron-sulfur subunit 2,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 2) (RISP2) Length = 272 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 279 TYSFLEDNKMLIG 241 TYSFLE+NK+LIG Sbjct: 260 TYSFLEENKLLIG 272
>UCRI_SOLTU (P37841) Ubiquinol-cytochrome c reductase iron-sulfur subunit,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein) (RISP) Length = 265 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 279 TYSFLEDNKMLIG 241 TYSFLE+NK+LIG Sbjct: 253 TYSFLEENKLLIG 265
>UCRI1_TOBAC (P49729) Ubiquinol-cytochrome c reductase iron-sulfur subunit 1,| mitochondrial precursor (EC 1.10.2.2) (Rieske iron-sulfur protein 1) (RISP1) (Fragment) Length = 258 Score = 27.7 bits (60), Expect = 7.9 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 279 TYSFLEDNKMLIG 241 TYSFLE+NK+LIG Sbjct: 246 TYSFLEENKLLIG 258 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,718,365 Number of Sequences: 219361 Number of extensions: 717728 Number of successful extensions: 1502 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 1473 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1502 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
