ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast21d10 |
|---|---|
| Clone Library Name | barley_pub |
>FPPS_MAIZE (P49353) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 350 Score = 72.0 bits (175), Expect = 4e-13 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F EYE+ESYKKLI DIEAQPSIAVQKVLKSFL KIYKRQK Sbjct: 311 FQEYENESYKKLIADIEAQPSIAVQKVLKSFLHKIYKRQK 350
>FPPS_HELAN (O64905) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 341 Score = 58.9 bits (141), Expect = 3e-09 Identities = 30/40 (75%), Positives = 31/40 (77%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F +YES SYKKLI IE PS AVQ VLKSFL KIYKRQK Sbjct: 302 FEDYESTSYKKLITSIEGHPSKAVQAVLKSFLGKIYKRQK 341
>FPPS1_LUPAL (P49351) Farnesyl pyrophosphate synthetase 1 (FPP synthetase 1)| (FPS 1) (Farnesyl diphosphate synthetase 1) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 58.5 bits (140), Expect = 4e-09 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F EYES+SY+KL+ IEA PS AVQ +LKSFL KIYKRQK Sbjct: 303 FTEYESKSYEKLVTSIEAHPSKAVQALLKSFLGKIYKRQK 342
>FPPS1_PARAR (O24241) Farnesyl pyrophosphate synthetase 1 (FPP synthetase 1)| (FPS 1) (Farnesyl diphosphate synthetase 1) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 57.8 bits (138), Expect = 7e-09 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F +YE+ SYKKLI IE PS AVQ VLKSFL KIYKRQK Sbjct: 303 FEDYENTSYKKLITSIEGHPSKAVQAVLKSFLGKIYKRQK 342
>FPPS_ARTAN (P49350) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 343 Score = 57.0 bits (136), Expect = 1e-08 Identities = 29/40 (72%), Positives = 31/40 (77%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F +YE+ SYKKLI IE PS AVQ VLKSFL KIYKRQK Sbjct: 304 FEDYEATSYKKLITSIENHPSKAVQAVLKSFLGKIYKRQK 343
>FPPS2_PARAR (O24242) Farnesyl pyrophosphate synthetase 2 (FPP synthetase 2)| (FPS 2) (Farnesyl diphosphate synthetase 2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 56.6 bits (135), Expect = 2e-08 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F +YE+ SYKKLI IE PS AVQ VLKSFL KIY+RQK Sbjct: 303 FEDYENTSYKKLITSIEGHPSKAVQAVLKSFLGKIYRRQK 342
>FPPS2_ARATH (Q43315) Farnesyl pyrophosphate synthetase 2 (FPP synthetase 2)| (FPS 2) (Farnesyl diphosphate synthetase 2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 53.5 bits (127), Expect = 1e-07 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F EYE ESY+KL IEA S A+Q VLKSFL KIYKRQK Sbjct: 303 FMEYEKESYEKLTKLIEAHQSKAIQAVLKSFLAKIYKRQK 342
>FPPS1_ARATH (Q09152) Farnesyl pyrophosphate synthetase 1, mitochondrial| precursor (FPP synthetase 1) (FPS 1) (Farnesyl diphosphate synthetase 1) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 384 Score = 52.4 bits (124), Expect = 3e-07 Identities = 27/40 (67%), Positives = 30/40 (75%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F EYES+SY+KL IE S A+Q VLKSFL KIYKRQK Sbjct: 345 FMEYESKSYEKLTGAIEGHQSKAIQAVLKSFLAKIYKRQK 384
>FPPS2_LUPAL (P49352) Farnesyl pyrophosphate synthetase 2 (FPP synthetase 2)| (FPS 2) (Farnesyl diphosphate synthetase 2) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 342 Score = 52.4 bits (124), Expect = 3e-07 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 + +YES+SY+KL+ IE PS AVQ VLKSF KIYKRQK Sbjct: 303 YADYESKSYEKLVTCIEGHPSKAVQGVLKSFWAKIYKRQK 342
>FPPS_CHICK (P08836) Farnesyl pyrophosphate synthetase (FPP synthetase) (FPS)| (Farnesyl diphosphate synthetase) [Includes: Dimethylallyltranstransferase (EC 2.5.1.1); Geranyltranstransferase (EC 2.5.1.10)] Length = 367 Score = 31.6 bits (70), Expect = 0.54 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = -3 Query: 284 FHEYESESYKKLIPDIEAQPSIAVQKVLKSFLPKIYKRQK 165 F +YE SY++L IE + +++ KIYKRQK Sbjct: 328 FQQYEESSYRRLQELIEKHSNRLPKEIFLGLAQKIYKRQK 367
>NLTP2_ORYSA (Q42978) Nonspecific lipid-transfer protein 2 precursor (LTP 2)| Length = 118 Score = 29.6 bits (65), Expect = 2.1 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +2 Query: 122 HTTTEQISCQKGNPTSAFCKSWAKRTSKPSEQQCLAGLQYQGSASCSS 265 HTT ISC + N + C S+A+ S PS C +G++ SA+ ++ Sbjct: 22 HTTMAAISCGQVNSAVSPCLSYARGGSGPS-AACCSGVRSLNSAASTT 68
>YAIH_LACLA (Q9CJB2) Hypothetical UPF0177 protein yaiH| Length = 236 Score = 28.5 bits (62), Expect = 4.6 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -3 Query: 107 RVLNHGLVLHVVCRALLPPIIIMQGAIPGL 18 RVL +++H + ALLP II+ I GL Sbjct: 204 RVLGESILVHCLMNALLPTIIVFLQTITGL 233
>FANCM_MOUSE (Q8BGE5) Fanconi anemia group M protein homolog (EC 3.6.1.-)| (ATP-dependent RNA helicase FANCM) (Protein FACM) Length = 2021 Score = 28.1 bits (61), Expect = 6.0 Identities = 21/72 (29%), Positives = 29/72 (40%), Gaps = 6/72 (8%) Frame = +2 Query: 89 NHDSTPYAFIKHTT--TEQISCQKGNPTSAFCKSWAKRTSKPSEQQCLAGLQYQGSAS-- 256 N +PY +H+ S GN + AKR S P+E+ CL G + + Sbjct: 999 NASCSPYPEHEHSPRPVSPASHSAGNSQQNLESNSAKRISHPTEKYCLPGTTHNKVSDRP 1058 Query: 257 --CSSRSHTHEI 286 C S S H I Sbjct: 1059 SFCESDSEGHNI 1070
>IBB1_SOYBN (P01055) Bowman-Birk type proteinase inhibitor precursor (BBI)| Length = 110 Score = 27.7 bits (60), Expect = 7.9 Identities = 15/66 (22%), Positives = 23/66 (34%) Frame = +2 Query: 62 RPDIQHEALNHDSTPYAFIKHTTTEQISCQKGNPTSAFCKSWAKRTSKPSEQQCLAGLQY 241 + D QH + S P +Q +C K NP C + + + C+ L Y Sbjct: 32 KSDHQHSNDDESSKPCC-------DQCACTKSNPPQCRCSDMRLNSCHSACKSCICALSY 84 Query: 242 QGSASC 259 C Sbjct: 85 PAQCFC 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,868,702 Number of Sequences: 219361 Number of extensions: 687041 Number of successful extensions: 1601 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1585 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1601 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
