| Clone Name | rbast19d10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | M3K14_MOUSE (Q9WUL6) Mitogen-activated protein kinase kinase kin... | 33 | 0.18 | 2 | ADEC2_BRAJA (Q89H53) Adenine deaminase 2 (EC 3.5.4.2) (Adenase 2... | 30 | 1.2 | 3 | QCRB_STRLI (Q9ZFB6) Ubiquinol-cytochrome c reductase cytochrome ... | 28 | 5.9 | 4 | SPEG_MOUSE (Q62407) Striated muscle-specific serine/threonine pr... | 28 | 7.7 |
|---|
>M3K14_MOUSE (Q9WUL6) Mitogen-activated protein kinase kinase kinase 14 (EC| 2.7.11.25) (NF-kappa beta-inducing kinase) (Serine/threonine-protein kinase NIK) Length = 942 Score = 33.1 bits (74), Expect = 0.18 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 193 AIHAMANMRPPWTGDGMDGRPPRQPRATRHHTRTEP 300 A+ + ++ PW G+ + RPP Q +AT H T P Sbjct: 656 ALQEVGGLKSPWKGEYKEPRPPPQDQATCHQTLPTP 691
>ADEC2_BRAJA (Q89H53) Adenine deaminase 2 (EC 3.5.4.2) (Adenase 2) (Adenine| aminase 2) Length = 625 Score = 30.4 bits (67), Expect = 1.2 Identities = 21/54 (38%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = -1 Query: 300 WFSARVMSRGPRLPRWPAVHSVSCPRRPHISHGMYGRDER---KADMLVVTGVE 148 WF AR RG L +P S P G YGRDE+ A+ L+VTG++ Sbjct: 142 WFEAR--RRGSPLKIFPQPGSAVPPTAYEWGGGWYGRDEQARFMAESLMVTGLD 193
>QCRB_STRLI (Q9ZFB6) Ubiquinol-cytochrome c reductase cytochrome b subunit| Length = 549 Score = 28.1 bits (61), Expect = 5.9 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 112 NTAELTTLPLFAFDAGDY*HICLPLVSAIHAMANMRPPWTGDGMDGRPPRQPRA 273 N + LP++ AG + + ++S + A+A + P W G G P R P A Sbjct: 255 NVVGMPLLPVYTAKAGGFFFLVFGVISVVSAIATINPIWP-SGPTG-PTRSPPA 306
>SPEG_MOUSE (Q62407) Striated muscle-specific serine/threonine protein kinase| (EC 2.7.11.1) (Aortic preferentially expressed protein 1) (APEG-1) Length = 3262 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 193 AIHAMANMRPPWTGDGMDGRPPRQPRATRHHTRTEP 300 A+ A PP +G G G P +PR+ RTEP Sbjct: 552 AVSPAATQPPPPSGAGKSGDEPGRPRSRGPVGRTEP 587 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,151,707 Number of Sequences: 219361 Number of extensions: 740294 Number of successful extensions: 2132 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2104 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2132 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)