ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast18h01 |
|---|---|
| Clone Library Name | barley_pub |
>PER1_HORVU (P27337) Peroxidase 1 precursor (EC 1.11.1.7)| Length = 315 Score = 36.6 bits (83), Expect = 0.016 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 APKTGTQGQIRL+CS VN Sbjct: 297 APKTGTQGQIRLSCSRVN 314
>PER2_ORYSA (P37835) Peroxidase 2 precursor (EC 1.11.1.7)| Length = 314 Score = 34.7 bits (78), Expect = 0.061 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 +P TGTQGQIRLNCS VN Sbjct: 297 SPLTGTQGQIRLNCSKVN 314
>PER1_WHEAT (Q05855) Peroxidase precursor (EC 1.11.1.7) (WP2)| Length = 312 Score = 33.9 bits (76), Expect = 0.10 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 AP TGTQGQIRL+CS VN Sbjct: 294 APLTGTQGQIRLSCSKVN 311
>PER33_ARATH (P24101) Peroxidase 33 precursor (EC 1.11.1.7) (Atperox P33)| (ATPCa) (Neutral peroxidase C) (PERC) Length = 354 Score = 33.9 bits (76), Expect = 0.10 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQGQIRLNC +VN Sbjct: 320 PTTGTQGQIRLNCRVVN 336
>PER34_ARATH (Q9SMU8) Peroxidase 34 precursor (EC 1.11.1.7) (Atperox P34)| (ATPCb) Length = 353 Score = 33.9 bits (76), Expect = 0.10 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQGQIRLNC +VN Sbjct: 319 PTTGTQGQIRLNCRVVN 335
>PER1A_ARMRU (P00433) Peroxidase C1A precursor (EC 1.11.1.7)| Length = 353 Score = 33.5 bits (75), Expect = 0.14 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQGQIRLNC +VN Sbjct: 319 PLTGTQGQIRLNCRVVN 335
>PER23_ARATH (O80912) Peroxidase 23 precursor (EC 1.11.1.7) (Atperox P23)| (ATP34) Length = 349 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVNP 274 P TGTQG+IR NC +VNP Sbjct: 317 PLTGTQGEIRQNCRVVNP 334
>PER22_ARATH (P24102) Peroxidase 22 precursor (EC 1.11.1.7) (Atperox P22)| (ATPEa) (Basic peroxidase E) Length = 349 Score = 32.7 bits (73), Expect = 0.23 Identities = 13/18 (72%), Positives = 15/18 (83%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVNP 274 P TGTQG+IR NC +VNP Sbjct: 317 PLTGTQGEIRQNCRVVNP 334
>PER1B_ARMRU (P15232) Peroxidase C1B precursor (EC 1.11.1.7)| Length = 351 Score = 32.3 bits (72), Expect = 0.30 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQG+IRLNC +VN Sbjct: 317 PLTGTQGEIRLNCRVVN 333
>PER1C_ARMRU (P15233) Peroxidase C1C precursor (EC 1.11.1.7) (Fragment)| Length = 332 Score = 32.3 bits (72), Expect = 0.30 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQG+IRLNC +VN Sbjct: 298 PLTGTQGEIRLNCRVVN 314
>SCNNH_XENLA (O13263) Amiloride-sensitive sodium channel gamma-2-subunit| (Epithelial Na(+) channel gamma-2 subunit) (Gamma-2 ENAC) (Nonvoltage-gated sodium channel 1 gamma-2 subunit) (SCNEG2) (Gamma-2 NACH) Length = 663 Score = 31.6 bits (70), Expect = 0.52 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +2 Query: 8 NMPHYYFCSINNFNTCTRWTIGKGISANLEHGNVYYS*V*AR 133 NM + C NN + CT +T G G++A E ++Y+ + A+ Sbjct: 202 NMVGFKLCDANNSSDCTIFTFGSGVNAIQEWYRLHYNNILAK 243
>PER32_ARATH (Q9LHB9) Peroxidase 32 precursor (EC 1.11.1.7) (Atperox P32)| (PRXR3) (ATP16a) Length = 352 Score = 31.2 bits (69), Expect = 0.67 Identities = 13/17 (76%), Positives = 14/17 (82%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQGQIR NC +VN Sbjct: 318 PLTGTQGQIRQNCRVVN 334
>PER2_ARMRU (P17179) Peroxidase C2 precursor (EC 1.11.1.7)| Length = 347 Score = 31.2 bits (69), Expect = 0.67 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 +P TG QG+IRLNC +VN Sbjct: 312 SPSTGKQGEIRLNCRVVN 329
>HERC2_HUMAN (O95714) HECT domain and RCC1-like domain-containing protein 2| Length = 4834 Score = 30.8 bits (68), Expect = 0.88 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 247 RWGDRDAPPPGLAR 206 +WGD+D PPPGL R Sbjct: 1880 KWGDQDGPPPGLGR 1893
>HERC2_MOUSE (Q4U2R1) HECT domain and RCC1-like domain-containing protein 2| Length = 4836 Score = 30.8 bits (68), Expect = 0.88 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -2 Query: 247 RWGDRDAPPPGLAR 206 +WGD+D PPPGL R Sbjct: 1881 KWGDQDGPPPGLGR 1894
>PER38_ARATH (Q9LDA4) Peroxidase 38 precursor (EC 1.11.1.7) (Atperox P38)| Length = 346 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 +P TG QG+IRLNC +VN Sbjct: 310 SPLTGKQGEIRLNCRVVN 327
>PER37_ARATH (Q9LDN9) Peroxidase 37 precursor (EC 1.11.1.7) (Atperox P37)| (ATP38) Length = 346 Score = 30.4 bits (67), Expect = 1.1 Identities = 12/18 (66%), Positives = 15/18 (83%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 +P TG QG+IRLNC +VN Sbjct: 310 SPLTGKQGEIRLNCRVVN 327
>PERE5_ARMRU (P59121) Peroxidase E5 (EC 1.11.1.7)| Length = 306 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQG+IR NC +VN Sbjct: 288 PLTGTQGEIRQNCRVVN 304
>PER3_ARMRU (P17180) Peroxidase C3 precursor (EC 1.11.1.7)| Length = 349 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 327 PKTGTQGQIRLNCSLVN 277 P TGTQG+IR NC +VN Sbjct: 317 PLTGTQGEIRQNCRVVN 333
>PERX_TOBAC (P11965) Lignin forming anionic peroxidase precursor (EC 1.11.1.7)| (TOPA) Length = 324 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 +P TGT GQIR +C VN Sbjct: 307 SPLTGTNGQIRTDCKRVN 324
>PER1_ARAHY (P22195) Cationic peroxidase 1 precursor (EC 1.11.1.7) (PNPC1)| Length = 316 Score = 27.3 bits (59), Expect = 9.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -3 Query: 330 APKTGTQGQIRLNCSLVN 277 +P TGT GQIR NC N Sbjct: 299 SPLTGTSGQIRTNCRKTN 316 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 41,842,423 Number of Sequences: 219361 Number of extensions: 717276 Number of successful extensions: 1485 Number of sequences better than 10.0: 21 Number of HSP's better than 10.0 without gapping: 1468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1485 length of database: 80,573,946 effective HSP length: 86 effective length of database: 61,708,900 effective search space used: 1481013600 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
