ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast18e01 |
|---|---|
| Clone Library Name | barley_pub |
>PRF1_LYCES (Q00451) 36.4 kDa proline-rich protein| Length = 346 Score = 52.8 bits (125), Expect = 2e-07 Identities = 23/38 (60%), Positives = 31/38 (81%), Gaps = 1/38 (2%) Frame = -2 Query: 361 CITIRARVLNINIYLPVALRLLI-TCGKHPPNGFQCPT 251 C TIR ++LNINI LP+AL++LI CGK+PP F+CP+ Sbjct: 308 CTTIRLKLLNINIILPIALQVLIDDCGKYPPKDFKCPS 345
>14KD_DAUCA (P14009) 14 kDa proline-rich protein DC2.15 precursor| Length = 137 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 1/36 (2%) Frame = -2 Query: 361 CITIRARVLNINIYLPVALRLLIT-CGKHPPNGFQC 257 C I+A +L N+ LP+AL L++ CGK PNGF+C Sbjct: 101 CTAIKANILGKNLNLPIALSLVLNNCGKQVPNGFEC 136
>CCDP_MAIZE (Q01595) Cortical cell-delineating protein precursor (Root-specific| protein ZRP3) Length = 129 Score = 33.5 bits (75), Expect = 0.13 Identities = 14/37 (37%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Frame = -2 Query: 361 CITIRARVLNINIYLPVALRLLIT-CGKHPPNGFQCP 254 C I+A VL I++ +P++L ++ CG+ P F CP Sbjct: 92 CTAIKANVLGIHLNVPLSLNFILNNCGRICPEDFTCP 128
>KR122_HUMAN (P59991) Keratin-associated protein 12-2 (Keratin-associated| protein 12.2) (High sulfur keratin-associated protein 12.2) Length = 146 Score = 32.0 bits (71), Expect = 0.38 Identities = 20/53 (37%), Positives = 24/53 (45%), Gaps = 4/53 (7%) Frame = -3 Query: 171 CGVGCYSACSLQCCA---CLRFVCVSIDLDRFSCSVLVVCR-SVATPCGFRPS 25 C C S C CCA C CV + SC V V C+ SV P F+P+ Sbjct: 2 CHTSCSSGCQPACCAPSPCQPACCVPSSC-QASCCVPVGCQSSVCVPVSFKPA 53
>KR10B_HUMAN (P60412) Keratin-associated protein 10-11 (Keratin-associated| protein 10.11) (High sulfur keratin-associated protein 10.11) (Keratin-associated protein 18-11) (Keratin-associated protein 18.11) Length = 298 Score = 30.8 bits (68), Expect = 0.85 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 3/44 (6%) Frame = -3 Query: 174 ACGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 AC GC S+C+ CC +C C S + +C V V C++V Sbjct: 66 ACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKTV 108
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 3/44 (6%) Frame = -3 Query: 174 ACGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 AC GC S+C+ CC +C C S + +C V V C+ V Sbjct: 66 ACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKPV 108
>KR104_HUMAN (P60372) Keratin-associated protein 10-4 (Keratin-associated| protein 10.4) (High sulfur keratin-associated protein 10.4) (Keratin-associated protein 18-4) (Keratin-associated protein 18.4) Length = 401 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C++V Sbjct: 196 CQSGCISSCTPSCCQQSSCQPACCTSSSCQQ-ACCVPVCCKTV 237 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C++V Sbjct: 77 CQSGCTSSCTPSCCQQSSCQLACCASSPCQQ-ACCVPVCCKTV 118
>KRUC_SHEEP (P26372) Keratin, ultra high-sulfur matrix protein (UHS keratin)| Length = 182 Score = 30.0 bits (66), Expect = 1.4 Identities = 17/58 (29%), Positives = 25/58 (43%), Gaps = 9/58 (15%) Frame = -3 Query: 204 GSRHSFTTILACGVGCYSACSLQCCACL---------RFVCVSIDLDRFSCSVLVVCR 58 GS+ + CG GC S+C + C C+ + C S + SC V V C+ Sbjct: 122 GSKGGCGSCGGCGSGCGSSCCVPVCCCVPACSCSSCGKGGCGSCGCSQSSCCVPVCCQ 179
>NPT2B_RAT (Q9JJ09) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 me Length = 695 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 216 PLWLGSRHSFTTILACGVGCYSACSLQCCACLRFVC 109 PLW+ S + I++ C+ +CC C R C Sbjct: 594 PLWMHSLKPWDNIISLATSCFQR---RCCCCCRVCC 626
>KR10C_HUMAN (P60413) Keratin-associated protein 10-12 (Keratin-associated| protein 10.12) (High sulfur keratin-associated protein 10.12) (Keratin-associated protein 18-12) (Keratin-associated protein 18.12) Length = 245 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C++V Sbjct: 72 CQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKTV 113
>KR106_HUMAN (P60371) Keratin-associated protein 10-6 (Keratin-associated| protein 10.6) (High sulfur keratin-associated protein 10.6) (Keratin-associated protein 18-6) (Keratin-associated protein 18.6) Length = 365 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C++V Sbjct: 77 CQSGCTSSCTPSCCQQSSCQLACCASSPCQQ-ACCVPVCCKTV 118
>GOGA2_RAT (Q62839) Golgin subfamily A member 2 (Cis-Golgi matrix protein| GM130) Length = 986 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/27 (55%), Positives = 16/27 (59%) Frame = +2 Query: 71 NTEQENRSRSIETHTNRRHAQHWSEQA 151 N EQE R +E R AQHWSEQA Sbjct: 485 NREQEGRMLELE-----REAQHWSEQA 506
>KR107_HUMAN (P60409) Keratin-associated protein 10-7 (Keratin-associated| protein 10.7) (High sulfur keratin-associated protein 10.7) (Keratin-associated protein 18-7) (Keratin-associated protein 18.7) Length = 370 Score = 29.3 bits (64), Expect = 2.5 Identities = 15/43 (34%), Positives = 22/43 (51%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C++V Sbjct: 77 CQSGCTSSCTPSCCQQSSCQLACCASSPCQQ-ACCVPVCCKTV 118 Score = 28.9 bits (63), Expect = 3.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C+ V Sbjct: 196 CQSGCISSCTPSCCQQSSCKPACCTSSPCQQ-ACCVPVCCKPV 237
>KR103_HUMAN (P60369) Keratin-associated protein 10-3 (Keratin-associated| protein 10.3) (High sulfur keratin-associated protein 10.3) (Keratin-associated protein 18-3) (Keratin-associated protein 18.3) Length = 221 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C+ V Sbjct: 67 CQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKPV 108
>HUG1_HUMAN (O75698) Protein HUG-1 (HOX11 upstream gene 1 protein)| Length = 362 Score = 28.5 bits (62), Expect = 4.2 Identities = 24/80 (30%), Positives = 34/80 (42%), Gaps = 1/80 (1%) Frame = +2 Query: 56 LLHTTNTEQENR-SRSIETHTNRRHAQHWSEQAL*HPTPHASMVVKLWREPSQSGHAG*A 232 LLH+ + R +RS +THT R A +WS P+PH + P +S Sbjct: 111 LLHSRAHGRTPRPTRSSQTHTTLRKAPNWSNSQQ-WPSPHPPLA------PPRSSFPTFV 163 Query: 233 RLGVEDGGALEAVGRVLAAG 292 G + G L G+ A G Sbjct: 164 GKGHRNAGQLRRTGQRRATG 183
>KR109_HUMAN (P60411) Keratin-associated protein 10-9 (Keratin-associated| protein 10.9) (High sulfur keratin-associated protein 10.9) (Keratin-associated protein 18-9) (Keratin-associated protein 18.9) Length = 292 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C V V C+ V Sbjct: 67 CQSGCTSSCTPSCCQQSSCQPAYCTSSPCQQ-ACCVPVCCKPV 108
>NPT2B_MOUSE (Q9DBP0) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 697 Score = 28.1 bits (61), Expect = 5.5 Identities = 10/36 (27%), Positives = 17/36 (47%) Frame = -3 Query: 216 PLWLGSRHSFTTILACGVGCYSACSLQCCACLRFVC 109 PLW+ S + +++ C+ +CC C R C Sbjct: 594 PLWMHSLKPWDNVISLATTCFQR---RCCCCCRVCC 626
>RYR1_PIG (P16960) Ryanodine receptor 1 (Skeletal muscle-type ryanodine| receptor) (RyR1) (RYR-1) (Skeletal muscle calcium release channel) Length = 5035 Score = 27.7 bits (60), Expect = 7.2 Identities = 13/34 (38%), Positives = 18/34 (52%) Frame = -2 Query: 295 ITCGKHPPNGFQCPTVLDA*PSLACMAALARLSP 194 +T PP+ F P + A P++ A ARLSP Sbjct: 1768 VTTSLRPPHHFSAPCFVAALPAVGAAEAPARLSP 1801
>MTMR5_HUMAN (O95248) SET-binding factor 1 (Sbf1) (Myotubularin-related protein| 5) Length = 1866 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 2/46 (4%) Frame = +2 Query: 89 RSRSIETHTNR--RHAQHWSEQAL*HPTPHASMVVKLWREPSQSGH 220 R R+ E H R RH Q +EQ + P+ ++ + + P +S H Sbjct: 452 RMRADENHPQRVLRHVQELAEQLYKNENPYPAVAMHKVQRPGESSH 497
>KR121_HUMAN (P59990) Keratin-associated protein 12-1 (Keratin-associated| protein 12.1) (High sulfur keratin-associated protein 12.1) Length = 96 Score = 27.3 bits (59), Expect = 9.4 Identities = 17/61 (27%), Positives = 19/61 (31%), Gaps = 13/61 (21%) Frame = -3 Query: 171 CGVGCYSACSLQCCA-------------CLRFVCVSIDLDRFSCSVLVVCRSVATPCGFR 31 C C S C CCA C VCV + C + SV P R Sbjct: 2 CHTSCSSGCQPACCAPSPCQASCYIPVGCQSSVCVPVSFKPAVCVPVRCQSSVCVPVSCR 61 Query: 30 P 28 P Sbjct: 62 P 62
>NPT2B_HUMAN (O95436) Sodium-dependent phosphate transport protein 2B| (Sodium/phosphate cotransporter 2B) (Na(+)/Pi cotransporter 2B) (Sodium-phosphate transport protein 2B) (Na(+)-dependent phosphate cotransporter 2B) (NaPi-2b) (Solute carrier family 34 Length = 690 Score = 27.3 bits (59), Expect = 9.4 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = -3 Query: 216 PLWLGSRHSFTTILACGVGCYSACSLQCCACLRFVC 109 PLW+ S + +++ GC+ CC C R C Sbjct: 594 PLWMRSLKPWDAVVSKFTGCFQMR---CCCCCRVCC 626
>CLAP1_HUMAN (Q7Z460) CLIP-associating protein 1 (Cytoplasmic linker-associated| protein 1) (Multiple asters homolog 1) Length = 1538 Score = 27.3 bits (59), Expect = 9.4 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = +1 Query: 85 KSVEVDRDAHKSQARTALERASTVA 159 K++E +D+HK R A E AST+A Sbjct: 1391 KTLEAHKDSHKEVVRAAEEAASTLA 1415
>KR101_HUMAN (P60331) Keratin-associated protein 10-1 (Keratin-associated| protein 10.1) (High sulfur keratin-associated protein 10.1) (Keratin-associated protein 18-1) (Keratin-associated protein 18.1) Length = 282 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/43 (32%), Positives = 21/43 (48%), Gaps = 3/43 (6%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRSV 52 C GC S+C+ CC +C C S + +C + V C+ V Sbjct: 67 CQSGCTSSCTPSCCQQSSCQPACCTSSPCQQ-ACCMPVCCKPV 108
>KR108_HUMAN (P60410) Keratin-associated protein 10-8 (Keratin-associated| protein 10.8) (High sulfur keratin-associated protein 10.8) (Keratin-associated protein 18-8) (Keratin-associated protein 18.8) Length = 259 Score = 27.3 bits (59), Expect = 9.4 Identities = 14/42 (33%), Positives = 20/42 (47%), Gaps = 3/42 (7%) Frame = -3 Query: 171 CGVGCYSACSLQCC---ACLRFVCVSIDLDRFSCSVLVVCRS 55 C GC +C+ CC +C C S + +C V V C+S Sbjct: 86 CQSGCTDSCTPSCCQQSSCQPACCTSSPCQQ-ACCVPVCCKS 126 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,004,914 Number of Sequences: 219361 Number of extensions: 909601 Number of successful extensions: 2626 Number of sequences better than 10.0: 24 Number of HSP's better than 10.0 without gapping: 2526 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2617 length of database: 80,573,946 effective HSP length: 96 effective length of database: 59,515,290 effective search space used: 1428366960 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
