| Clone Name | rbast18c03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RNC_STRMU (Q8DT66) Ribonuclease III (EC 3.1.26.3) (RNase III) | 32 | 0.56 | 2 | HIS3_CHLTE (Q8KF68) Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.... | 29 | 3.6 | 3 | BIR1G_MOUSE (Q9JIB3) Baculoviral IAP repeat-containing protein 1... | 28 | 6.1 | 4 | BIR1F_MOUSE (Q9JIB6) Baculoviral IAP repeat-containing protein 1... | 28 | 6.1 | 5 | GPRS_DROME (O61366) Serine-enriched protein | 28 | 6.1 |
|---|
>RNC_STRMU (Q8DT66) Ribonuclease III (EC 3.1.26.3) (RNase III)| Length = 231 Score = 31.6 bits (70), Expect = 0.56 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = -2 Query: 178 LRALLMRKPLLEGFSRNFHVSRFLKL 101 +R++++R+ L GFSRN H R++KL Sbjct: 77 MRSMIVREESLAGFSRNCHFDRYIKL 102
>HIS3_CHLTE (Q8KF68) Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) (PRA-CH)| Length = 137 Score = 28.9 bits (63), Expect = 3.6 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +3 Query: 33 TWRHHEAWLWHRSLTKLWLASQQSFRNRET*KFLENPSNKGLRIKRARRGFGRHLIPCSC 212 T +A W RS KLWL + S +E L + L +K +++G H+ SC Sbjct: 49 TLEKKKACYWSRSRNKLWLKGESSGNMQEVHDILIDCDGDTLLLKVSQKGGACHVGYHSC 108
>BIR1G_MOUSE (Q9JIB3) Baculoviral IAP repeat-containing protein 1g (Neuronal| apoptosis inhibitory protein 7) Length = 1402 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 6 KGVHNNSGYTWRHHEAWLWHRSLTKLWLASQQSF 107 + + N Y H + +LW + + LWL S +SF Sbjct: 823 ENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESF 856
>BIR1F_MOUSE (Q9JIB6) Baculoviral IAP repeat-containing protein 1f (Neuronal| apoptosis inhibitory protein 6) Length = 1403 Score = 28.1 bits (61), Expect = 6.1 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = +3 Query: 6 KGVHNNSGYTWRHHEAWLWHRSLTKLWLASQQSF 107 + + N Y H + +LW + + LWL S +SF Sbjct: 823 ENMSENEDYMKLHPQTFLWFQFVRGLWLVSPESF 856
>GPRS_DROME (O61366) Serine-enriched protein| Length = 1302 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 39 RHHEAWLWHRSLTKLWLASQQSFRNRET*KFLENPSN 149 +HH H+SL K+ A QSFR R + +P+N Sbjct: 338 QHHRHRHHHQSLPKIRKAKSQSFRTRRSPSERRSPNN 374 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,574,828 Number of Sequences: 219361 Number of extensions: 499185 Number of successful extensions: 1403 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1393 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1403 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)