| Clone Name | rbast18b08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxid... | 44 | 8e-05 | 2 | GOX_SPIOL (P05414) Peroxisomal (S)-2-hydroxy-acid oxidase (EC 1.... | 43 | 2e-04 | 3 | GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxid... | 42 | 3e-04 | 4 | GATD_ARCFU (O29380) Glutamyl-tRNA(Gln) amidotransferase subunit ... | 28 | 6.1 | 5 | WECF_PHOLL (Q7MYM4) 4-alpha-L-fucosyltransferase (EC 2.4.1.-) (T... | 28 | 8.0 |
|---|
>GOX1_ARATH (Q9LRS0) Probable peroxisomal (S)-2-hydroxy-acid oxidase 1 (EC| 1.1.3.15) (Glycolate oxidase 1) (GOX 1) (Short chain alpha-hydroxy acid oxidase 1) Length = 367 Score = 44.3 bits (103), Expect = 8e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 273 RDELELAMALSGCASLRDITRAHVVTDGD 187 RDE EL MALSGC SL +ITR H+VT+ D Sbjct: 331 RDEFELTMALSGCRSLSEITRNHIVTEWD 359
>GOX_SPIOL (P05414) Peroxisomal (S)-2-hydroxy-acid oxidase (EC 1.1.3.15)| (Glycolate oxidase) (GOX) (Short chain alpha-hydroxy acid oxidase) Length = 369 Score = 43.1 bits (100), Expect = 2e-04 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 273 RDELELAMALSGCASLRDITRAHVVTDGD 187 RDE EL MALSGC SL++I+R+H+ D D Sbjct: 331 RDEFELTMALSGCRSLKEISRSHIAADWD 359
>GOX2_ARATH (Q9LRR9) Probable peroxisomal (S)-2-hydroxy-acid oxidase 2 (EC| 1.1.3.15) (Glycolate oxidase 2) (GOX 2) (Short chain alpha-hydroxy acid oxidase 2) Length = 367 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/29 (62%), Positives = 23/29 (79%) Frame = -2 Query: 273 RDELELAMALSGCASLRDITRAHVVTDGD 187 RDE EL MALSGC SL++I+R H+ T+ D Sbjct: 331 RDEFELTMALSGCRSLKEISRNHITTEWD 359
>GATD_ARCFU (O29380) Glutamyl-tRNA(Gln) amidotransferase subunit D (EC 6.3.5.-)| (Glu-ADT subunit D) Length = 418 Score = 28.1 bits (61), Expect = 6.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 3/36 (8%) Frame = +2 Query: 2 CMHPSPIFISTSTNYCQIHRSIKLEE---QERAAFQ 100 CMH S TS +YC +HR +K+ + R AFQ Sbjct: 223 CMHGS-----TSDDYCLVHRGVKVRKNHTSRRDAFQ 253
>WECF_PHOLL (Q7MYM4) 4-alpha-L-fucosyltransferase (EC 2.4.1.-)| (TDP-Fuc4NAc:lipid II Fuc4NAc transferase) (Fuc4NAc transferase) Length = 361 Score = 27.7 bits (60), Expect = 8.0 Identities = 13/47 (27%), Positives = 28/47 (59%), Gaps = 2/47 (4%) Frame = -1 Query: 151 EAPHTASSTICARALVDLKCRSFLFLQFDRSMYLAII--RTRRNKDW 17 ++ + + + A+A D CR F QF+ S++LA++ + +R++ W Sbjct: 61 DSKKSLAQAVIAQACSDRDCRFFFHGQFNVSLWLALLSGKIKRHQFW 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,712,178 Number of Sequences: 219361 Number of extensions: 277565 Number of successful extensions: 881 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 862 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 80,573,946 effective HSP length: 66 effective length of database: 66,096,120 effective search space used: 1586306880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)