| Clone Name | rbast18a09 |
|---|---|
| Clone Library Name | barley_pub |
>URB1_USTMA (P40349) Siderophore biosynthesis regulatory protein URBS1| Length = 950 Score = 28.5 bits (62), Expect = 4.5 Identities = 21/72 (29%), Positives = 33/72 (45%) Frame = +1 Query: 40 PSRRSTSIEKKHFRCNTRKAENSLPCLCSQYYRISKPA*AAADVSTHTQHNISFFRKVET 219 P+ RS +H R + +SLP + + R S P+ AAD + + HN S V Sbjct: 50 PADRSPERVSQHSRGASVHDADSLPPIRPRGSRPSSPSGHAADRAPSSHHNASSTATVPA 109 Query: 220 TPTSHNLLLEGR 255 T+ +L + R Sbjct: 110 RSTARSLFRDPR 121
>BRCA1_BOVIN (Q864U1) Breast cancer type 1 susceptibility protein homolog| Length = 1849 Score = 28.5 bits (62), Expect = 4.5 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 1/44 (2%) Frame = +2 Query: 74 ISAATPEKQKTACLACVHSITG*ANQLELLLM-FRHTHNTTFPF 202 + A TPEK KTA CV T N EL+ F+ T N T F Sbjct: 778 LEAKTPEKAKTAPNPCVSLCTATKNLKELIHRDFKDTKNNTEGF 821
>RIP3_MOMCH (P24817) Ribosome-inactivating protein beta-momorcharin precursor| (EC 3.2.2.22) (rRNA N-glycosidase) (MAP 30) (B-MMC) Length = 286 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 169 VSTHTQHNISFFRKVETTPTSHNLLLEGRGKIIFPY 276 V + ++S+F K E+ P ++N+L +G KI PY Sbjct: 94 VVAYRTRDVSYFFK-ESPPEAYNILFKGTRKITLPY 128
>RIP2_MOMBA (P29339) Ribosome-inactivating protein momordin II precursor (EC| 3.2.2.22) (rRNA N-glycosidase) Length = 286 Score = 28.1 bits (61), Expect = 5.9 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 169 VSTHTQHNISFFRKVETTPTSHNLLLEGRGKIIFPY 276 V + ++S+F K E+ P ++N+L +G KI PY Sbjct: 94 VVAYRTRDVSYFFK-ESPPEAYNILFKGTRKITLPY 128
>DDL_STRMU (P95803) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 349 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = -3 Query: 225 RCSFNLTEKGNVVLCVCRNISSSSSWFAYPVI 130 RC F LTE G V L + + W YP++ Sbjct: 287 RCDFFLTEDGKVYLNELNTMPGFTQWSMYPLL 318
>DDL_LACLA (Q9CIL5) D-alanine--D-alanine ligase (EC 6.3.2.4) (D-alanylalanine| synthetase) (D-Ala-D-Ala ligase) Length = 349 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 225 RCSFNLTEKGNVVLCVCRNISSSSSWFAYPVI 130 RC F +T+ GNV L I + W YP++ Sbjct: 287 RCDFFVTKDGNVYLNEINAIPGFTQWSMYPLL 318
>UHRF2_HUMAN (Q96PU4) Ubiquitin-like PHD and RING finger domain-containing| protein 2 (EC 6.3.2.-) (Ubiquitin-like-containing PHD and RING finger domains protein 2) (Np95/ICBP90-like RING finger protein) (Np95-like RING finger protein) (Nuclear zinc finger Length = 802 Score = 27.7 bits (60), Expect = 7.7 Identities = 11/28 (39%), Positives = 17/28 (60%), Gaps = 4/28 (14%) Frame = -2 Query: 202 KRKC----CVVCVSKHQQQLKLVCLSCN 131 ++KC C VC KH+ ++L+C CN Sbjct: 339 EKKCHSCSCRVCGGKHEPNMQLLCDECN 366
>STE16_SCHPO (Q09743) Protein ste16| Length = 1309 Score = 27.7 bits (60), Expect = 7.7 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 160 AADVSTHTQHNISFFRKVETTPTSHNLLLEG-RGKI 264 A D+S+H + N F +K+ TT + LLE +GK+ Sbjct: 12 ALDISSHAKTNGDFIKKMNTTDSKRLKLLEDLKGKL 47
>VU54_HHV6U (P24434) Protein U54| Length = 458 Score = 27.7 bits (60), Expect = 7.7 Identities = 12/30 (40%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -3 Query: 225 RCSFNLTEKGNVVLCVCRNISS-SSSWFAY 139 +C +T + V+C+CR+ SS +SS F Y Sbjct: 32 KCGLGITPPSSAVVCICRDESSFTSSPFTY 61 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,099,540 Number of Sequences: 219361 Number of extensions: 784622 Number of successful extensions: 1748 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 1727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1748 length of database: 80,573,946 effective HSP length: 76 effective length of database: 63,902,510 effective search space used: 1533660240 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)