| Clone Name | rbast18a06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | 5NG4_PINTA (Q6J163) Auxin-induced protein 5NG4 | 120 | 1e-27 | 2 | YJT3_YEAST (P39542) Hypothetical protein YJL193w | 33 | 0.21 |
|---|
>5NG4_PINTA (Q6J163) Auxin-induced protein 5NG4| Length = 410 Score = 120 bits (302), Expect = 1e-27 Identities = 54/69 (78%), Positives = 62/69 (89%) Frame = -3 Query: 418 YLIGHCLSWSGWLVLQAPVLKKYPAKLSVTSYTCFFGVIQFLIIAAFFERDAGAWVFHSG 239 YL+G+CL+WSGW+VLQAPVLK+YPA+LSVTS+TCFFGVIQFLIIAAFFE D W HSG Sbjct: 203 YLLGNCLAWSGWIVLQAPVLKRYPARLSVTSFTCFFGVIQFLIIAAFFETDLEHWKIHSG 262 Query: 238 SEVFTILYA 212 E+FTILYA Sbjct: 263 GELFTILYA 271
>YJT3_YEAST (P39542) Hypothetical protein YJL193w| Length = 402 Score = 33.5 bits (75), Expect = 0.21 Identities = 18/70 (25%), Positives = 35/70 (50%) Frame = -3 Query: 415 LIGHCLSWSGWLVLQAPVLKKYPAKLSVTSYTCFFGVIQFLIIAAFFERDAGAWVFHSGS 236 L+G CLS+ ++ L+ PVL +Y +++ +S + ++ F FH Sbjct: 279 LVGFCLSFGWFITLEFPVLFRYFFQINSSSTVIKAFPVSLFLLNGTFHFIQAMITFHLLG 338 Query: 235 EVFTILYAVS 206 EV T+ Y+++ Sbjct: 339 EVSTLTYSIA 348 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,299,913 Number of Sequences: 219361 Number of extensions: 721685 Number of successful extensions: 1652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1629 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1652 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2286875994 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)