| Clone Name | rbast17h06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 pr... | 30 | 1.2 | 2 | NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 prec... | 30 | 2.1 | 3 | ATL1E_ARATH (Q9C7E9) Putative RING-H2 finger protein ATL1E | 30 | 2.1 |
|---|
>NOTC2_MOUSE (O35516) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| (Motch B) [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2470 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 151 HRRSAPACCCWNLKDCSMACLSYLC 77 H S P C C N KDC C S C Sbjct: 1357 HTDSGPRCFCLNPKDCESGCASNPC 1381
>NOTC2_RAT (Q9QW30) Neurogenic locus notch homolog protein 2 precursor (Notch 2)| [Contains: Notch 2 extracellular truncation; Notch 2 intracellular domain] Length = 2471 Score = 29.6 bits (65), Expect = 2.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = -3 Query: 151 HRRSAPACCCWNLKDCSMACLSYLC 77 H S P C C N KDC C S C Sbjct: 1359 HTASGPHCFCPNHKDCESGCASNPC 1383
>ATL1E_ARATH (Q9C7E9) Putative RING-H2 finger protein ATL1E| Length = 336 Score = 29.6 bits (65), Expect = 2.1 Identities = 16/41 (39%), Positives = 18/41 (43%), Gaps = 2/41 (4%) Frame = +2 Query: 161 KQYNTTSKGFTRTN--GMEVARWRCGNCRGCNHFLSRCGRK 277 K T KGF+ G + W NCRGC RCG K Sbjct: 163 KDVITEEKGFSTVPWLGNVLLEWSSPNCRGCEKESLRCGFK 203 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,381,764 Number of Sequences: 219361 Number of extensions: 616989 Number of successful extensions: 1593 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1586 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)