| Clone Name | rbast17g03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-) | 31 | 0.69 | 2 | MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, trac... | 28 | 5.9 |
|---|
>XYL1_ARATH (Q9S7Y7) Alpha-xylosidase precursor (EC 3.2.1.-)| Length = 915 Score = 31.2 bits (69), Expect = 0.69 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = -3 Query: 302 RGVTMEVGGLELPLGKSFTMTWNMHI 225 + V +EV GLE+ +GK F M+W M I Sbjct: 889 KSVMVEVRGLEMLVGKDFNMSWKMGI 914
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 28.1 bits (61), Expect = 5.9 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = +1 Query: 4 FHSPARLSFNG*IRVHKWCSRVTNPHTSYITDSSTMN 114 F P LS WCSR+T+P++++ S +N Sbjct: 605 FEDPCSLSVENENYARHWCSRLTDPNSAFSRCHSIIN 641 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,233,125 Number of Sequences: 219361 Number of extensions: 539698 Number of successful extensions: 1589 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1588 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)