| Clone Name | rbast16e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PURQ_THEAC (Q9HIM1) Phosphoribosylformylglycinamidine synthase I... | 28 | 5.5 | 2 | NUDH_PHOLL (Q7N8U7) Probable (di)nucleoside polyphosphate hydrol... | 27 | 9.4 |
|---|
>PURQ_THEAC (Q9HIM1) Phosphoribosylformylglycinamidine synthase I (EC 6.3.5.3)| (FGAM synthase I) Length = 257 Score = 28.1 bits (61), Expect = 5.5 Identities = 12/42 (28%), Positives = 22/42 (52%) Frame = +1 Query: 214 SSNKVTEYECMDPFVTLTEVSAIFLCTDGSRGFLQVPPVHVK 339 ++N+ +EC ++T+T + IF +G QVP H + Sbjct: 117 TNNESGRFECRYTYITMTSDNPIFRDAFKGKGSFQVPVAHAE 158
>NUDH_PHOLL (Q7N8U7) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 176 Score = 27.3 bits (59), Expect = 9.4 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 5/54 (9%) Frame = -3 Query: 201 TPDFDSMMHVSYHY-----IDSQRDSIAEVQRKLLYWDIPKEEIIAVPVLSNLY 55 TP+FD VSY Y + +RD V ++ +P +E +++P S Y Sbjct: 118 TPEFDGWRWVSYWYPVRQVVSFKRDVYRRVMKEFASVVMPMQESVSLPRSSYSY 171 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,599,885 Number of Sequences: 219361 Number of extensions: 981923 Number of successful extensions: 2583 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2477 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2582 length of database: 80,573,946 effective HSP length: 94 effective length of database: 59,954,012 effective search space used: 1438896288 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)