| Clone Name | rbast16a05 |
|---|---|
| Clone Library Name | barley_pub |
>LRC15_MOUSE (Q80X72) Leucine-rich repeat-containing protein 15 precursor| Length = 579 Score = 32.0 bits (71), Expect = 0.40 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 308 VVDVVAERNSRAVCSCLCCRKRKNRVVCLSVRVP 207 V+ ++A S A C C CC K++++ V + ++ P Sbjct: 543 VIGIIALACSLAACICCCCCKKRSQAVLMQMKAP 576
>EDIL3_MOUSE (O35474) EGF-like repeat and discoidin I-like domain-containing| protein 3 precursor (EGF-like repeats and discoidin I-like domains protein 3) (Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1) Length = 480 Score = 32.0 bits (71), Expect = 0.40 Identities = 23/85 (27%), Positives = 32/85 (37%), Gaps = 8/85 (9%) Frame = -3 Query: 306 CRCSSGKKLPCCL*LFVLSKKEEQSRLSVGPC--------AHCGXXXXXXXEDSSGLVSR 151 C C G P C + ++ EE+ S GPC C + G V + Sbjct: 48 CECPEGFAGPNCSSVVEVASDEEKPT-SAGPCIPNPCHNGGTCEISEAYRGDTFIGYVCK 106 Query: 150 CLGGALGFAGLHVKRQINRRRSSPC 76 C GF G+H + IN + PC Sbjct: 107 C---PRGFNGIHCQHNINECEAEPC 128
>LRC15_RAT (Q8R5M3) Leucine-rich repeat-containing protein 15 precursor (rLib)| Length = 578 Score = 32.0 bits (71), Expect = 0.40 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -1 Query: 308 VVDVVAERNSRAVCSCLCCRKRKNRVVCLSVRVP 207 V+ ++A S A C C CC K++++ V + ++ P Sbjct: 542 VIGIIALACSLAACICCCCCKKRSQAVLMQMKAP 575
>EDIL3_HUMAN (O43854) EGF-like repeat and discoidin I-like domain-containing| protein 3 precursor (EGF-like repeats and discoidin I-like domains protein 3) (Developmentally-regulated endothelial cell locus 1 protein) (Integrin-binding protein DEL1) Length = 480 Score = 31.2 bits (69), Expect = 0.69 Identities = 23/85 (27%), Positives = 31/85 (36%), Gaps = 8/85 (9%) Frame = -3 Query: 306 CRCSSGKKLPCCL*LFVLSKKEEQSRLSVGPCAH--------CGXXXXXXXEDSSGLVSR 151 C C G P C + ++ EE+ S GPC C + G V + Sbjct: 48 CECPDGFTDPNCSSVVEVASDEEEPT-SAGPCTPNPCHNGGTCEISEAYRGDTFIGYVCK 106 Query: 150 CLGGALGFAGLHVKRQINRRRSSPC 76 C GF G+H + IN PC Sbjct: 107 C---PRGFNGIHCQHNINECEVEPC 128
>JHD2B_HUMAN (Q7LBC6) JmjC domain-containing histone demethylation protein 2B| (EC 1.14.11.-) (Jumonji domain-containing protein 1B) (Nuclear protein 5qNCA) Length = 1761 Score = 30.4 bits (67), Expect = 1.2 Identities = 19/38 (50%), Positives = 21/38 (55%) Frame = -3 Query: 174 DSSGLVSRCLGGALGFAGLHVKRQINRRRSSPCSALWQ 61 DSS LVS LG AL G + N R SSP S+L Q Sbjct: 697 DSSKLVSGVLGSALTSGGPSLSAMGNGRSSSPTSSLTQ 734
>LRC15_HUMAN (Q8TF66) Leucine-rich repeat-containing protein 15 precursor (hLib)| Length = 581 Score = 27.7 bits (60), Expect = 7.6 Identities = 11/34 (32%), Positives = 20/34 (58%) Frame = -1 Query: 308 VVDVVAERNSRAVCSCLCCRKRKNRVVCLSVRVP 207 V+ +VA S A C CC K++++ V + ++ P Sbjct: 545 VIGIVALACSLAACVGCCCCKKRSQAVLMQMKAP 578
>Y841_HAEIN (P44898) Hypothetical protein HI0841| Length = 585 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +2 Query: 8 TAMFHFYNLLSLFILWNTCQRAEQGELLRRFICLFTCSP 124 TA+F+ +NL ++WN E GE+ R + F P Sbjct: 111 TAVFNRFNLHLSSVVWNLLVNPENGEMSRDWQIFFAPMP 149
>GFRA3_HUMAN (O60609) GDNF family receptor alpha-3 precursor (GFR-alpha-3)| Length = 400 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -1 Query: 287 RNSRAVCSCLCCRKRKNRVVCLSV 216 RNS + C+C R+ KN+V CL + Sbjct: 94 RNSSLI-GCMCHRRMKNQVACLDI 116
>EBS1_ASHGO (Q751B2) Protein EBS1| Length = 775 Score = 27.3 bits (59), Expect = 10.0 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +2 Query: 47 ILWNTCQRAEQGELLRRFICLFTCSPAKPKAPP 145 I+W C +++ L+ + L TCSP K K PP Sbjct: 536 IVW--CDESKRFNSLKPDVPLRTCSPPKAKTPP 566
>THIE_MYCLE (Q9ZBL5) Probable thiamine-phosphate pyrophosphorylase (EC 2.5.1.3)| (TMP pyrophosphorylase) (TMP-PPase) (Thiamine-phosphate synthase) Length = 235 Score = 27.3 bits (59), Expect = 10.0 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -2 Query: 151 MSWWCFGFCWTACKKTNKPAQKLSLLCSLASVPKDE 44 + ++C G CW K ++PA L L+ + A + D+ Sbjct: 149 VDYFCVGPCWPTPTKPDRPAPGLELVRAAAELAGDK 184
>MCLN2_HUMAN (Q8IZK6) Mucolipin-2| Length = 538 Score = 27.3 bits (59), Expect = 10.0 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = -1 Query: 290 ERNSRAVCSCLCCRKRK 240 ++ S A SC+CCR+RK Sbjct: 512 QKESSAFLSCICCRRRK 528 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,759,521 Number of Sequences: 219361 Number of extensions: 743414 Number of successful extensions: 2043 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2040 length of database: 80,573,946 effective HSP length: 79 effective length of database: 63,244,427 effective search space used: 1517866248 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)