| Clone Name | rbast15h08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRA20_CAEEL (O17844) Serpentine receptor class alpha-20 (Protein... | 31 | 0.72 | 2 | SRA24_CAEEL (O62368) Serpentine receptor class alpha-24 (Protein... | 28 | 4.6 |
|---|
>SRA20_CAEEL (O17844) Serpentine receptor class alpha-20 (Protein sra-20)| Length = 339 Score = 31.2 bits (69), Expect = 0.72 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 10/72 (13%) Frame = -2 Query: 190 FAFT*YVNLLCYFILVRPIQSISNNQS--------LLYRTIQSIKHEF*LCLICV--IYR 41 F F V LL Y+ V I+++ NN L+ + S+ H+ + I + +YR Sbjct: 32 FVFLATVILLSYYFAVLAIRALWNNNIFSNSTRLILIVCLLNSVVHQSTMMEIRIRQVYR 91 Query: 40 QIYFRRDPCRLP 5 + +PCRLP Sbjct: 92 SFVYSSEPCRLP 103
>SRA24_CAEEL (O62368) Serpentine receptor class alpha-24 (Protein sra-24)| Length = 339 Score = 28.5 bits (62), Expect = 4.6 Identities = 19/46 (41%), Positives = 24/46 (52%), Gaps = 2/46 (4%) Frame = -2 Query: 136 IQSISNNQSLLYRTIQSIKHEF*LCLICV--IYRQIYFRRDPCRLP 5 I S S LL + SI H+ + I + IYR I F +PCRLP Sbjct: 58 IFSNSTRLILLVCLLNSIIHQTTMLEIRIRQIYRSIVFASEPCRLP 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,008,731 Number of Sequences: 219361 Number of extensions: 586905 Number of successful extensions: 1058 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1044 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1057 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)