| Clone Name | rbast15f06 |
|---|---|
| Clone Library Name | barley_pub |
>RHM1_ARATH (Q9SYM5) Probable rhamnose biosynthetic enzyme 1 (EC 4.2.1.-) (EC| 1.1.1.-) Length = 669 Score = 65.1 bits (157), Expect = 6e-11 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -3 Query: 413 VIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPNQKT 291 VIVAPRSNNE+D KLK EFPELLSIKESLIK + PN+KT Sbjct: 629 VIVAPRSNNEMDASKLKKEFPELLSIKESLIKYAYGPNKKT 669
>RHM3_ARATH (Q9LH76) Probable rhamnose biosynthetic enzyme 3 (EC 4.2.1.-) (EC| 1.1.1.-) Length = 664 Score = 63.9 bits (154), Expect = 1e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -3 Query: 413 VIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPNQKT 291 VIVAPRSNNE+D KL EFPE+LSIK+SLIK VF+PN++T Sbjct: 624 VIVAPRSNNEMDGAKLSKEFPEMLSIKDSLIKYVFEPNKRT 664
>RHM2_ARATH (Q9LPG6) Probable rhamnose biosynthetic enzyme 2 (EC 4.2.1.-) (EC| 1.1.1.-) (RHAMNOSE BIOSYNTHESIS 2 protein) (NDP-rhamnose synthase) (MUCILAGE-MODIFIED4 protein) (UDP-L-rhamnose synthase MUM4) Length = 667 Score = 60.5 bits (145), Expect = 2e-09 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 413 VIVAPRSNNELDTVKLKTEFPELLSIKESLIKNVFKPNQKT 291 VIVA RSNNE+D KL EFPE+LSIKESL+K VF+PN++T Sbjct: 627 VIVAARSNNEMDGSKLSKEFPEMLSIKESLLKYVFEPNKRT 667
>ATG2_YEAST (P53855) Autophagy-related protein 2 (Sporulation-specific protein| 72) Length = 1592 Score = 28.9 bits (63), Expect = 4.9 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 4/69 (5%) Frame = -1 Query: 310 SNQIRRHPRLDQMEQ----CAQSLMLMLLVRHTFTSLSGANPISMRSVLFRPGRVHALLL 143 SN+ P++ Q EQ C +SLM + + F LS N + M +++ VH L + Sbjct: 269 SNEDPSEPQVTQEEQENDKCKESLMEINNLNIAFKGLSSVNDLRMSNIVIDIQDVH-LAI 327 Query: 142 QEIVSYRKS 116 +IV + S Sbjct: 328 HKIVEIKNS 336
>KPC1_CANAL (P43057) Protein kinase C-like 1 (EC 2.7.11.13) (PKC 1)| Length = 1097 Score = 28.5 bits (62), Expect = 6.4 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 113 IPCHYQIITQN-TTWCCYCIL*IRWEMDRVRNKVLC 9 IP ++ IT + T WCC+C + W VR C Sbjct: 479 IPHRFEPITNHGTKWCCHCGYILPWGKKNVRKCTEC 514
>DAL80_YEAST (P26343) Nitrogen regulatory protein DAL80 (Regulatory protein| UGA43) Length = 269 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/33 (36%), Positives = 22/33 (66%) Frame = -3 Query: 392 NNELDTVKLKTEFPELLSIKESLIKNVFKPNQK 294 +NE + +KLKT+ EL + + K++F+ N+K Sbjct: 217 HNEEEVIKLKTKISELELVTDLYKKHIFQLNEK 249 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,757,539 Number of Sequences: 219361 Number of extensions: 1300012 Number of successful extensions: 2719 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2683 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2719 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)