| Clone Name | rbast15f05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PRLPI_MOUSE (Q9QUN5) Placental prolactin-like protein I precurso... | 33 | 0.14 | 2 | NETO1_MOUSE (Q8R4I7) Neuropilin and tolloid-like protein 1 precu... | 30 | 2.0 | 3 | NETO1_HUMAN (Q8TDF5) Neuropilin and tolloid-like protein 1 precu... | 30 | 2.0 | 4 | LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) ... | 28 | 7.8 |
|---|
>PRLPI_MOUSE (Q9QUN5) Placental prolactin-like protein I precursor (PRL-like| protein I) (PLP-I) (Decidualin) (Prolactin-like protein J) (PRL-like protein J) (PLP-J) Length = 212 Score = 33.5 bits (75), Expect = 0.14 Identities = 19/63 (30%), Positives = 34/63 (53%) Frame = +3 Query: 12 DNLLQTKPCVYKMKPREQIRNCQHEVMYTSLTEGPCQLNSHTSECRFVVSHSWYVHVKKG 191 DNLL + ++++ + ++++ + LTEG C N +T C+ + +HS VKK Sbjct: 42 DNLLSSSRHIHRVAKK------MYKILDSKLTEGVCFRNKNTKMCQTISTHS----VKKN 91 Query: 192 ESL 200 E L Sbjct: 92 EDL 94
>NETO1_MOUSE (Q8R4I7) Neuropilin and tolloid-like protein 1 precursor| (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1) Length = 533 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +3 Query: 12 DNLLQTKPCVYKMKPREQIRNCQHEVMYTSLTEGPCQLNS---HTSEC 146 D +L+T V +M E RN + ++++TS E PC+ N+ H++ C Sbjct: 257 DVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSNMC 304
>NETO1_HUMAN (Q8TDF5) Neuropilin and tolloid-like protein 1 precursor| (Brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 1) Length = 533 Score = 29.6 bits (65), Expect = 2.0 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = +3 Query: 12 DNLLQTKPCVYKMKPREQIRNCQHEVMYTSLTEGPCQLNS---HTSEC 146 D +L+T V +M E RN + ++++TS E PC+ N+ H++ C Sbjct: 257 DVMLRTGLGVIRMWADEGSRNSRFQMLFTSFQEPPCEGNTFFCHSNMC 304
>LAMB2_HUMAN (P55268) Laminin beta-2 chain precursor (S-laminin) (Laminin B1s| chain) Length = 1798 Score = 27.7 bits (60), Expect = 7.8 Identities = 11/33 (33%), Positives = 16/33 (48%) Frame = +3 Query: 48 MKPREQIRNCQHEVMYTSLTEGPCQLNSHTSEC 146 + PR +IR + +Y + G C H SEC Sbjct: 260 LDPRREIREKYYYALYELVVRGNCFCYGHASEC 292 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,724,519 Number of Sequences: 219361 Number of extensions: 904113 Number of successful extensions: 1941 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1907 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1941 length of database: 80,573,946 effective HSP length: 74 effective length of database: 64,341,232 effective search space used: 1544189568 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)