| Clone Name | rbast15e12 |
|---|---|
| Clone Library Name | barley_pub |
>RFA2_RAT (Q63528) Replication protein A 32 kDa subunit (RP-A) (RF-A)| (Replication factor-A protein 2) (p32) Length = 270 Score = 41.6 bits (96), Expect = 5e-04 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -2 Query: 350 LPALKIKEAIDYHVDVGHIYSTIDDFHYKS 261 +P IK+A+D+ + GHIYST+DD H+KS Sbjct: 237 MPVASIKQAVDFLCNEGHIYSTVDDDHFKS 266
>RFA2_MOUSE (Q62193) Replication protein A 32 kDa subunit (RP-A) (RF-A)| (Replication factor-A protein 2) (p32) Length = 270 Score = 40.8 bits (94), Expect = 8e-04 Identities = 16/30 (53%), Positives = 23/30 (76%) Frame = -2 Query: 350 LPALKIKEAIDYHVDVGHIYSTIDDFHYKS 261 +P IK+A+D+ + GHIYST+DD H+KS Sbjct: 237 MPVPSIKQAVDFLCNEGHIYSTVDDDHFKS 266
>RFA2_HUMAN (P15927) Replication protein A 32 kDa subunit (RP-A) (RF-A)| (Replication factor-A protein 2) (p32) (p34) Length = 270 Score = 38.1 bits (87), Expect = 0.005 Identities = 15/25 (60%), Positives = 21/25 (84%) Frame = -2 Query: 335 IKEAIDYHVDVGHIYSTIDDFHYKS 261 IK+A+D+ + GHIYST+DD H+KS Sbjct: 242 IKQAVDFLSNEGHIYSTVDDDHFKS 266
>RFA4_HUMAN (Q13156) Replication protein A 30 kDa subunit (RP-A) (RF-A)| (Replication factor-A protein 4) (p30) Length = 261 Score = 37.0 bits (84), Expect = 0.012 Identities = 17/26 (65%), Positives = 19/26 (73%) Frame = -2 Query: 335 IKEAIDYHVDVGHIYSTIDDFHYKSA 258 IKEAIDY GHIY T+D H+KSA Sbjct: 235 IKEAIDYLTVEGHIYPTVDREHFKSA 260
>RFA2_PONPY (Q5RC43) Replication protein A 32 kDa subunit (RP-A) (RF-A)| (Replication factor-A protein 2) (p32) Length = 270 Score = 37.0 bits (84), Expect = 0.012 Identities = 14/25 (56%), Positives = 21/25 (84%) Frame = -2 Query: 335 IKEAIDYHVDVGHIYSTIDDFHYKS 261 +K+A+D+ + GHIYST+DD H+KS Sbjct: 242 VKQAMDFLSNEGHIYSTVDDDHFKS 266
>SRPX_RAT (Q63769) Sushi repeat-containing protein SRPX precursor (DRS| protein) (Down-regulated by v-SRC) Length = 464 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/48 (33%), Positives = 22/48 (45%), Gaps = 1/48 (2%) Frame = +2 Query: 173 PSGGYLSSTAKDRC*RVKTALGYRLSRRT-LTCSGNHRWSSRCARHQR 313 P GGY + RC ++ GY L + L C N RWS + Q+ Sbjct: 72 PPGGYYKTALGTRC-DIRCRKGYELHGSSQLVCQSNRRWSDKVICKQK 118
>PYRR_FUSNN (Q8RG90) PyrR bifunctional protein [Includes: Pyrimidine operon| regulatory protein; Uracil phosphoribosyltransferase (EC 2.4.2.9) (UPRTase)] Length = 177 Score = 28.5 bits (62), Expect = 4.1 Identities = 22/62 (35%), Positives = 30/62 (48%) Frame = +1 Query: 16 IMILLDDALITSRLIRF*STGILSNTCPWSIIPYIQANRCGHVSLKLRRGDASFGGIPKQ 195 +++++DD L T R IR ILS + P I +R GH L + R D IP Sbjct: 99 VVVIVDDVLYTGRTIRAGLDAILSKSRPAKIQLACLIDR-GHRELPI-RADFIGKNIPTS 156 Query: 196 HS 201 HS Sbjct: 157 HS 158
>RFA2_SCHPO (Q92373) Replication factor-A protein 2 (Single-stranded| DNA-binding protein P30 subunit) Length = 279 Score = 28.5 bits (62), Expect = 4.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -2 Query: 347 PALKIKEAIDYHVDVGHIYSTIDDFHYKSAFVD 249 P + + D+ G IY+TID+ H+KS D Sbjct: 246 PGIDLTAVTDFLQQEGIIYTTIDENHFKSVLQD 278
>RNAS1_HORSE (P00674) Ribonuclease pancreatic (EC 3.1.27.5) (RNase 1) (RNase A)| Length = 128 Score = 28.5 bits (62), Expect = 4.1 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = -3 Query: 274 STTSQRSSTKSVTECRLHSLASVLSCAA*VSPRRKHLL 161 S Q SS+ +T+CRL S + +CA S + +H++ Sbjct: 70 SNCYQSSSSMHITDCRLTSGSKYPNCAYQTSQKERHII 107
>RNS1B_PYGNE (Q8SPN3) Ribonuclease 1B pancreatic precursor (EC 3.1.27.5) (RNase| 1B) Length = 156 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 256 SSTKSVTECRLHSLASVLSCAA*VSPRRKHLL 161 +S +TECRL + + +CA SP+ +H++ Sbjct: 104 NSKMHITECRLTNGSKYPNCAYQTSPKERHII 135
>RPOC_MYCPU (Q98Q24) DNA-directed RNA polymerase beta' chain (EC 2.7.7.6) (RNAP| beta' subunit) (Transcriptase beta' chain) (RNA polymerase beta' subunit) Length = 1426 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/50 (30%), Positives = 27/50 (54%) Frame = -2 Query: 359 RFRLPALKIKEAIDYHVDVGHIYSTIDDFHYKSAFVD*VCNRVPSSLASI 210 R +P K+++ + D G+I+ST+ F + AF + SS++SI Sbjct: 621 RVAIPFKKLQKTFNLKGDKGYIFSTVGKFIFNQAFPENFPFIFDSSVSSI 670
>YN81_CAEEL (Q03610) Hypothetical protein ZC84.1 in chromosome III| Length = 1416 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/56 (33%), Positives = 24/56 (42%) Frame = -3 Query: 268 TSQRSSTKSVTECRLHSLASVLSCAA*VSPRRKHLLAGV*ERHDHIC*PECRE*CS 101 T QR S + TE +HS + SCAA VS + H+C P CS Sbjct: 269 TCQRGSPQYSTESAVHSERPITSCAASVSCANDFQCTAI--GSQHLCCPTPGSVCS 322
>SPG16_MOUSE (Q8K450) Sperm-associated antigen 16 protein (PF20 protein homolog)| Length = 639 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +2 Query: 167 MLPSGGYLSSTAKDRC*RVKTALGYRLSRRTLTCSGNHRWSSRCARHQRGSR 322 M P YL S ++DR ++ +G LT SG+ W S C H GS+ Sbjct: 368 MHPCRDYLISCSEDRLWKM---VGLPQGNVLLTGSGHTDWLSGCCFHPSGSK 416
>RNAS1_PREEN (P19644) Ribonuclease pancreatic (EC 3.1.27.5) (RNase 1) (RNase A)| Length = 128 Score = 27.7 bits (60), Expect = 7.0 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = -3 Query: 256 SSTKSVTECRLHSLASVLSCAA*VSPRRKHLL 161 +S +TECRL + + +CA SP+ +H++ Sbjct: 76 NSRMHITECRLTNGSKYPNCAYGTSPKERHII 107
>YGL4_BACST (P32814) Hypothetical 35.5 kDa protein in gldA 3'region (ORF4)| Length = 301 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = +1 Query: 112 PYIQANRCGHVSLKLRRGDASFGGIPKQHS*GQMLASED 228 PY N +VS LR GDA G P + S G LA+ + Sbjct: 160 PYFDVNCTNYVSQCLRAGDAPMRGYPNRSS-GWWLANNN 197
>LFC_TACTR (P28175) Limulus clotting factor C precursor (EC 3.4.21.84) (FC)| [Contains: Limulus clotting factor C heavy chain; Limulus clotting factor C light chain; Limulus clotting factor C chain A; Limulus clotting factor C chain B] Length = 1019 Score = 27.3 bits (59), Expect = 9.2 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = +2 Query: 104 ASFPTFRLTDVV-MSLSNSGEEMLPSGGYLS-STAKDRC*RVKTALGYRLSRRTLTCSGN 277 +SFP + + +S G+ PSG + +T + C + Y + + TLTC GN Sbjct: 189 SSFPPKCIRECAKVSSPEHGKVNAPSGNMIEGATLRFSC----DSPYYLIGQETLTCQGN 244 Query: 278 HRWSSR 295 +WS + Sbjct: 245 GQWSGQ 250
>EXOC4_ARATH (Q93YU5) Probable exocyst complex component 4 (Exocyst complex| component Sec8) Length = 1053 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/22 (45%), Positives = 15/22 (68%) Frame = +2 Query: 116 TFRLTDVVMSLSNSGEEMLPSG 181 TFR TD +S+SN G +++ G Sbjct: 564 TFRFTDATVSISNQGADLIRQG 585 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,960,792 Number of Sequences: 219361 Number of extensions: 893146 Number of successful extensions: 1972 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1936 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1972 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 1396778976 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)