| Clone Name | rbast15d09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MBB1_CHLRE (Q9FNS4) PsbB mRNA maturation factor Mbb1, chloroplas... | 29 | 3.6 | 2 | TPSN_CHICK (O73895) Tapasin precursor (TPSN) (TPN) (TAP-binding ... | 28 | 6.2 |
|---|
>MBB1_CHLRE (Q9FNS4) PsbB mRNA maturation factor Mbb1, chloroplast precursor| Length = 662 Score = 28.9 bits (63), Expect = 3.6 Identities = 25/81 (30%), Positives = 36/81 (44%), Gaps = 6/81 (7%) Frame = -2 Query: 256 SGSGSSHAPRRPRKDGWWQWHANACSRTYVLLLLYHPT*LI------TPRHATPCSSGKV 95 S S SS + RR W+A A S+T V + Y PT ++ R +TP S + Sbjct: 24 SSSSSSSSSRRT-------WYAPARSQTGVQVAAYEPTAVLQLAPSAVSRRSTPVRSSII 76 Query: 94 SDRLSLPARAAFGSRFQSTTS 32 +D S + G R +T S Sbjct: 77 ADLSSSGSGDGEGERGDATGS 97
>TPSN_CHICK (O73895) Tapasin precursor (TPSN) (TPN) (TAP-binding protein)| (TAP-associated protein) Length = 430 Score = 28.1 bits (61), Expect = 6.2 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = -2 Query: 253 GSGSSHAPRRPRKDGWWQWHANACSRTY 170 GSG+S +PR D W H A TY Sbjct: 319 GSGTSQSPRDTVMDSWTSGHRQAADGTY 346 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,278,131 Number of Sequences: 219361 Number of extensions: 602018 Number of successful extensions: 1470 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1470 length of database: 80,573,946 effective HSP length: 63 effective length of database: 66,754,203 effective search space used: 1602100872 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)