| Clone Name | rbast15b10 |
|---|---|
| Clone Library Name | barley_pub |
>GALM_MOUSE (Q8K157) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 31.6 bits (70), Expect = 0.59 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFS 143 + P FP +++RPG+ Y H F+FS Sbjct: 316 NQPQFPPALLRPGEEYNHTTWFKFS 340
>GALM_RAT (Q66HG4) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 30.4 bits (67), Expect = 1.3 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFS 143 + P FP ++RPG+ Y H F+FS Sbjct: 316 NQPQFPPILLRPGEEYNHTTWFKFS 340
>GALM_PONPY (Q5R8U1) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFS 143 + P FP ++RPG+ Y H F+FS Sbjct: 316 NQPRFPPVLLRPGEEYDHTTWFKFS 340
>GALM_HUMAN (Q96C23) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| (BLOCK25 protein) Length = 342 Score = 30.0 bits (66), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFS 143 + P FP ++RPG+ Y H F+FS Sbjct: 316 NQPRFPPVLLRPGEEYDHTTWFKFS 340
>GALM_BOVIN (Q5EA79) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 29.3 bits (64), Expect = 2.9 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFS 143 + P+FP +++PG+ Y H F+FS Sbjct: 316 NQPHFPPVLLKPGEEYDHTTWFKFS 340
>GALM_ACICA (P05149) Aldose 1-epimerase precursor (EC 5.1.3.3) (Mutarotase)| Length = 381 Score = 27.7 bits (60), Expect = 8.5 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFSYQ 137 + P FPS+ + P Q Y VF+F Q Sbjct: 354 NQPTFPSTRLNPNQTYNSVTVFKFGVQ 380
>GALM_PIG (Q9GKX6) Aldose 1-epimerase (EC 5.1.3.3) (Galactose mutarotase)| Length = 342 Score = 27.7 bits (60), Expect = 8.5 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -1 Query: 217 DHPNFPSSIVRPGQVYKHDMVFRFS 143 + P+FP +++PG+ Y H F FS Sbjct: 316 NQPHFPPVLLKPGEEYNHTTWFVFS 340
>CDH_HELPJ (Q9ZKX9) CDP-diacylglycerol pyrophosphatase (EC 3.6.1.26)| (CDP-diacylglycerol phosphatidylhydrolase) (CDP-diglyceride hydrolase) Length = 244 Score = 27.7 bits (60), Expect = 8.5 Identities = 15/45 (33%), Positives = 23/45 (51%) Frame = +2 Query: 26 SCPNATFYYTSYQHVTAQSTRKRRMISHYDVLCVVGSLVGKSENH 160 S PN F+Y S+Q S + + I Y + + S G+S+NH Sbjct: 89 STPN--FFYLSWQARDFMSKKYGKPIPDYAISLTINSKKGRSQNH 131 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.317 0.128 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 32,645,345 Number of Sequences: 219361 Number of extensions: 496702 Number of successful extensions: 1360 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1360 length of database: 80,573,946 effective HSP length: 47 effective length of database: 70,263,979 effective search space used: 1686335496 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)