ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast15b07 |
|---|---|
| Clone Library Name | barley_pub |
>NIR_NEUCR (P38681) Nitrite reductase [NAD(P)H] (EC 1.7.1.4)| Length = 1176 Score = 30.4 bits (67), Expect = 1.1 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 5/60 (8%) Frame = -3 Query: 308 STARCRRSPVKPGMAVWTWRCASPRT-----PWAASSPTTNSCSSCHMHLDGVHRIWLSC 144 S + C S + P R +SP T P ++++P T + SSC + G W+SC Sbjct: 999 SPSSCSSSALPPSPPSTPPRSSSPVTSPPQSPTSSATPATTASSSCTTNPSGPASPWISC 1058
>DDHB_RHOSU (Q8GPG3) Dimethylsulfide dehydrogenase beta subunit| (Dimethylsulfide iron-sulfur subunit) (DMS DH beta subunit) (DMS DH iron-sulfur subunit) Length = 325 Score = 30.0 bits (66), Expect = 1.5 Identities = 8/18 (44%), Positives = 15/18 (83%) Frame = +3 Query: 264 CHPRLDRGTPTSCRRTCL 317 C+PR+++G PT+C + C+ Sbjct: 195 CYPRIEKGLPTACAKQCV 212
>UBP4_HUMAN (Q13107) Ubiquitin carboxyl-terminal hydrolase 4 (EC 3.1.2.15)| (Ubiquitin thioesterase 4) (Ubiquitin-specific-processing protease 4) (Deubiquitinating enzyme 4) (Ubiquitous nuclear protein homolog) Length = 963 Score = 29.6 bits (65), Expect = 1.9 Identities = 22/63 (34%), Positives = 28/63 (44%), Gaps = 1/63 (1%) Frame = -3 Query: 344 GRWPCGVAEQTSSTARCRRSPVKPGMAVWTWRCASPRTPWAAS-SPTTNSCSSCHMHLDG 168 G WP + SSTA R P + ASP + +AS +S S+C MH G Sbjct: 222 GTWPRQTLQSKSSTAPSRNFTTSPKSS------ASPYSSVSASLIANGDSTSTCGMHSSG 275 Query: 167 VHR 159 V R Sbjct: 276 VSR 278
>Y801_DEIRA (Q9RW68) Putative carotenoid cyclase DR0801| Length = 410 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/30 (53%), Positives = 18/30 (60%), Gaps = 2/30 (6%) Frame = -3 Query: 341 RWPCGVAEQTSS--TARCRRSPVKPGMAVW 258 R+P G A QT+ AR RR PV PG VW Sbjct: 150 RFPGGAALQTAYGVVARFRRPPVTPGSMVW 179
>VGLL1_HUMAN (Q99990) Transcription cofactor vestigial-like protein 1 (Vgl-1)| (TONDU protein) Length = 258 Score = 29.3 bits (64), Expect = 2.5 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = -3 Query: 254 WRCASPRTPWAASSPTTNSCSSCHMHLDG 168 WR +SP T P TN ++C++H+ G Sbjct: 80 WRYSSPWTKPQPEVPVTNRAANCNLHVPG 108
>NARY_ECOLI (P19318) Respiratory nitrate reductase 2 beta chain (EC 1.7.99.4)| Length = 514 Score = 29.3 bits (64), Expect = 2.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 264 CHPRLDRGTPTSCRRTCL 317 C+PR++ G PT C TC+ Sbjct: 246 CYPRIESGQPTVCSETCV 263
>NARH_SHIFL (Q83RN5) Respiratory nitrate reductase 1 beta chain (EC 1.7.99.4)| Length = 512 Score = 29.3 bits (64), Expect = 2.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 264 CHPRLDRGTPTSCRRTCL 317 C+PR++ G PT C TC+ Sbjct: 247 CYPRIEAGQPTVCSETCV 264
>NARH_ECOLI (P11349) Respiratory nitrate reductase 1 beta chain (EC 1.7.99.4)| (Nitrate reductase A beta subunit) (Quinol-nitrate oxidoreductase beta subunit) Length = 512 Score = 29.3 bits (64), Expect = 2.5 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +3 Query: 264 CHPRLDRGTPTSCRRTCL 317 C+PR++ G PT C TC+ Sbjct: 247 CYPRIEAGQPTVCSETCV 264
>NARH_BACSU (P42176) Nitrate reductase beta chain (EC 1.7.99.4)| Length = 487 Score = 28.9 bits (63), Expect = 3.3 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 264 CHPRLDRGTPTSCRRTCL 317 C PRL+ G PT C TC+ Sbjct: 244 CFPRLEAGLPTICSETCV 261
>HIPL1_ARATH (Q9SSG3) HIPL1 protein precursor| Length = 695 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/25 (48%), Positives = 19/25 (76%) Frame = -3 Query: 236 RTPWAASSPTTNSCSSCHMHLDGVH 162 R P +SSP+++S SSC+ H++G H Sbjct: 653 RNPGTSSSPSSSS-SSCYKHINGFH 676
>IF2_NOCFA (Q5YSC6) Translation initiation factor IF-2| Length = 969 Score = 28.5 bits (62), Expect = 4.3 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = -3 Query: 335 PCGVAEQTSSTARCRRSP-VKPGMAVWTWRCASPRTPWAASSP 210 P AEQT+ R P VKPG A R A+P P A ++P Sbjct: 94 PQAPAEQTARPTDARPGPAVKPGPAPTPARPAAPEAPAAKAAP 136
>Y1289_MYCBO (P64786) Hypothetical protein Mb1289| Length = 268 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 305 TARCRRSPVKPGMAVWTWRCASPRTPWAASS 213 T R RSPV+PG W A+P+TP AA + Sbjct: 5 TGRAFRSPVEPGSG-WPGDPATPQTPVAADA 34
>Y1259_MYCTU (P64785) Hypothetical protein Rv1259/MT1297.1| Length = 268 Score = 28.5 bits (62), Expect = 4.3 Identities = 15/31 (48%), Positives = 19/31 (61%) Frame = -3 Query: 305 TARCRRSPVKPGMAVWTWRCASPRTPWAASS 213 T R RSPV+PG W A+P+TP AA + Sbjct: 5 TGRAFRSPVEPGSG-WPGDPATPQTPVAADA 34
>SH3BG_HUMAN (P55822) SH3 domain-binding glutamic acid-rich protein (SH3BGR| protein) (21-glutamic acid-rich protein) (21-GARP) Length = 239 Score = 28.1 bits (61), Expect = 5.6 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -3 Query: 248 CASPRTPWAASSPTTNSCSSCH 183 C SP PWAA+SP CH Sbjct: 18 CRSPVDPWAAASPDLALACLCH 39
>ACRA_ECOLI (P0AE06) Acriflavine resistance protein A precursor| Length = 397 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 25 KSSTYLLRSNMCYTHVTCPATTPISGSHVTSYALV 129 K++ R N+ YT VT P + I S+VT ALV Sbjct: 161 KAAVETARINLAYTKVTSPISGRIGKSNVTEGALV 195
>ACRA_ECO57 (P0AE07) Acriflavine resistance protein A precursor| Length = 397 Score = 28.1 bits (61), Expect = 5.6 Identities = 15/35 (42%), Positives = 20/35 (57%) Frame = +1 Query: 25 KSSTYLLRSNMCYTHVTCPATTPISGSHVTSYALV 129 K++ R N+ YT VT P + I S+VT ALV Sbjct: 161 KAAVETARINLAYTKVTSPISGRIGKSNVTEGALV 195
>SEM5B_HUMAN (Q9P283) Semaphorin-5B precursor| Length = 1093 Score = 25.4 bits (54), Expect(2) = 6.7 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +2 Query: 92 RSVVAMSHPMRWYRRTTYKTARCGAPHQGACDTN 193 R+ +A H +++ RR T +T C A G+CDT+ Sbjct: 745 RAPLADPHGLQFGRRRT-ETRTCPADGSGSCDTD 777 Score = 20.8 bits (42), Expect(2) = 6.7 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +3 Query: 285 GTPTSCRRTCLLGHSARPPPC 347 G +SC R C LG R C Sbjct: 802 GPWSSCSRDCELGFRVRKRTC 822
>ACRE_ECOLI (P24180) Acriflavine resistance protein E precursor (Protein envC)| Length = 385 Score = 27.7 bits (60), Expect = 7.3 Identities = 16/42 (38%), Positives = 22/42 (52%) Frame = +1 Query: 4 DSTLQLYKSSTYLLRSNMCYTHVTCPATTPISGSHVTSYALV 129 D+ + K++ R N+ YT VT P + I S VT ALV Sbjct: 153 DAAVIAAKATVESARINLAYTKVTAPISGRIGKSTVTEGALV 194
>UL47_EHV1V (Q6S6Q8) 97 kDa alpha trans-inducing protein (Tegument protein)| (GP10) Length = 871 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 77 VRRPHRSVVAMSHPMRWYRRT--TYKTAR 157 +RRP RS+ + SHP R T TY T R Sbjct: 13 IRRPRRSIESRSHPFRATGNTQRTYSTPR 41
>UL47_EHV1B (P28929) 97 kDa alpha trans-inducing protein (Tegument protein)| (GP10) Length = 871 Score = 27.7 bits (60), Expect = 7.3 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = +2 Query: 77 VRRPHRSVVAMSHPMRWYRRT--TYKTAR 157 +RRP RS+ + SHP R T TY T R Sbjct: 13 IRRPRRSIESRSHPFRATGNTQRTYSTPR 41
>GDF9_CAPHI (Q66NC0) Growth/differentiation factor 9 precursor (GDF-9)| Length = 453 Score = 27.3 bits (59), Expect = 9.5 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = +1 Query: 190 ELQEFVVGEEAAHGVRGEAH 249 EL + VGEEAA GVR H Sbjct: 297 ELSAYPVGEEAAEGVRSSRH 316
>PFA3_DEBHA (Q6BMV2) Palmitoyltransferase PFA3 (EC 2.3.1.-) (Protein fatty| acyltransferase 3) Length = 405 Score = 27.3 bits (59), Expect = 9.5 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 94 SVWSPDMSHVCNTC 53 SVW PD H C+TC Sbjct: 173 SVWKPDRCHHCSTC 186
>DHSB_PORPU (P80477) Succinate dehydrogenase [ubiquinone] iron-sulfur protein| (EC 1.3.5.1) (IP) Length = 239 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -3 Query: 197 CSSCHMHLDGVHRIWLSCMLSYGTSA*DVTWLPL 96 C SC M++DG++ L+C+ T+A +T PL Sbjct: 68 CGSCSMNIDGINT--LACLKPIKTNANIITIYPL 99
>DHSB_CHOCR (P48932) Succinate dehydrogenase [ubiquinone] iron-sulfur protein| (EC 1.3.5.1) (IP) Length = 250 Score = 27.3 bits (59), Expect = 9.5 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = -3 Query: 197 CSSCHMHLDGVHRIWLSCMLSYGTSA*DVTWLPL 96 C SC M++DG + L+C+ S T + +T PL Sbjct: 78 CGSCSMNIDGTNS--LACLRSLNTKSNFITIYPL 109
>CAC1G_RAT (O54898) Voltage-dependent T-type calcium channel alpha-1G subunit| (Voltage-gated calcium channel alpha subunit Cav3.1) Length = 2254 Score = 27.3 bits (59), Expect = 9.5 Identities = 19/54 (35%), Positives = 27/54 (50%), Gaps = 7/54 (12%) Frame = -3 Query: 329 GVAEQTSSTARCRRSP--VKPGMAVWTWRC-----ASPRTPWAASSPTTNSCSS 189 GV E S +R S +PG A +C +SP +PW+A+S T+ SS Sbjct: 1035 GVGEALGSGSRRTSSSGSAEPGAAHHEMKCPPSARSSPHSPWSAASSWTSRRSS 1088
>UL47_EHV4 (P25073) 97 kDa alpha trans-inducing protein (Tegument protein)| (GP10) Length = 872 Score = 27.3 bits (59), Expect = 9.5 Identities = 14/29 (48%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = +2 Query: 77 VRRPHRSVVAMSHPMRWYRRT--TYKTAR 157 +RRP RS+ SHP R T TY T R Sbjct: 13 IRRPRRSIETRSHPFRAAGNTQRTYSTPR 41 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 57,635,810 Number of Sequences: 219361 Number of extensions: 1161128 Number of successful extensions: 3533 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 3383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3531 length of database: 80,573,946 effective HSP length: 91 effective length of database: 60,612,095 effective search space used: 1454690280 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
