| Clone Name | rbast15a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DPOL_NPVBM (P41712) DNA polymerase (EC 2.7.7.7) | 28 | 5.5 | 2 | CH60_PLAFG (P34940) Chaperonin CPN60, mitochondrial precursor | 28 | 7.1 |
|---|
>DPOL_NPVBM (P41712) DNA polymerase (EC 2.7.7.7)| Length = 986 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 8 LLYYNNKFLHRFSTRQKENLHKMKTSINRQGSPDLLYTRR*KGLIK 145 L + N+ L F QK+NL K T+I ++ + LY R+ L+K Sbjct: 889 LCTFMNELLEIFGDEQKDNLAKCFTAIMQKYMQNQLYDRKEPVLVK 934
>CH60_PLAFG (P34940) Chaperonin CPN60, mitochondrial precursor| Length = 700 Score = 27.7 bits (60), Expect = 7.1 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 2 RELLYYNNKFLHRFSTRQKENLHKMKTSINRQGSPDLLY 118 + L Y N+K + +R+KEN KMK + N+ D++Y Sbjct: 40 KRLKYINSKII----SRRKENYVKMKMTENKVKGKDIIY 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,936,400 Number of Sequences: 219361 Number of extensions: 815346 Number of successful extensions: 1558 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1523 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1558 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)