| Clone Name | rbast14h04 |
|---|---|
| Clone Library Name | barley_pub |
>U139_ARATH (Q9SD88) UPF0139 protein At5g07960| Length = 107 Score = 70.5 bits (171), Expect = 1e-12 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = -3 Query: 373 CAQSLANMKNFENDLKQLSMAFMFAVMGLVTNYFGPRPGGTKR 245 CAQSLANM+N ENDLKQ+SMA MFA+MGLVTNY GP TK+ Sbjct: 65 CAQSLANMRNLENDLKQISMAMMFAIMGLVTNYLGPNRPATKK 107
>CNTP4_HUMAN (Q9C0A0) Contactin-associated protein-like 4 precursor (Cell| recognition molecule Caspr4) Length = 1308 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/49 (28%), Positives = 24/49 (48%) Frame = -2 Query: 200 RCLGSYCHGGDRISESLSRARVKCTTSSVRDQDMYHDAQYNLFARSCSS 54 RCL +YC G S+S S CT + R ++ +++ +SC + Sbjct: 552 RCLPNYCEHGGECSQSWSTFHCNCTNTGYRGATCHN----SIYEQSCEA 596
>CP39A_HUMAN (Q9NYL5) Cytochrome P450 39A1 (EC 1.14.13.99)| (24-hydroxycholesterol 7-alpha-hydroxylase) (Oxysterol 7-alpha-hydroxylase) (hCYP39A1) Length = 469 Score = 27.7 bits (60), Expect = 7.1 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -2 Query: 317 HGFHVCCHGFGDKLFWASSRWYKALICRLCAV*SFLLKFRC 195 H F C FG F +RW+ L ++C + L K+ C Sbjct: 398 HSFLDCFMAFGSGKFQCPARWFALLEVQMCII-LILYKYDC 437
>GYRA_BACHD (O50628) DNA gyrase subunit A (EC 5.99.1.3)| Length = 833 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 148 VGHASNVPPHQLG 110 VG A+N+PPHQLG Sbjct: 177 VGMATNIPPHQLG 189
>GYRA_BACSU (P05653) DNA gyrase subunit A (EC 5.99.1.3)| Length = 821 Score = 27.3 bits (59), Expect = 9.2 Identities = 10/13 (76%), Positives = 12/13 (92%) Frame = -3 Query: 148 VGHASNVPPHQLG 110 VG A+N+PPHQLG Sbjct: 177 VGMATNIPPHQLG 189
>VWF_MOUSE (Q8CIZ8) Von Willebrand factor precursor (vWF) [Contains: Von| Willebrand antigen II] Length = 2813 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 367 QSLANMKNFENDLKQLSMAFMFAVMGLVTNYFGPRPGGTK 248 QSL ++ E Q+ A FAV + + G RPG +K Sbjct: 1755 QSLVDLMQQEGGPSQIGDALAFAVRYVTSQIHGARPGASK 1794
>ACSA1_ACEXY (P21877) Cellulose synthase 1 [Includes: Cellulose synthase| catalytic domain [UDP-forming] (EC 2.4.1.12); Cyclic di-GMP-binding domain (Cellulose synthase 1 regulatory domain)] Length = 1550 Score = 27.3 bits (59), Expect = 9.2 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = -1 Query: 78 FICTVLFFQLFYKDSRRAFAYLSTL 4 F+C V+FF + +K SRR+ +L L Sbjct: 57 FVCVVIFFIVGHKPSRRSQIFLEVL 81 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 53,012,852 Number of Sequences: 219361 Number of extensions: 1036875 Number of successful extensions: 2105 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2040 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2105 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 1407308304 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)