ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast14f09 |
|---|---|
| Clone Library Name | barley_pub |
>RS3_ICTPU (Q90YS2) 40S ribosomal protein S3| Length = 245 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PKEE Sbjct: 197 KIGPKKPLPDHVSIVEPKEE 216
>RS3_DROME (Q06559) 40S ribosomal protein S3| Length = 246 Score = 30.0 bits (66), Expect = 1.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEEDELRPP 260 K+GP PLPD V++ PKEE P Sbjct: 199 KIGPKKPLPDNVSVVEPKEEKIYETP 224
>RS3_RAT (P62909) 40S ribosomal protein S3| Length = 243 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS3_PONPY (Q5R465) 40S ribosomal protein S3| Length = 243 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS3_MOUSE (P62908) 40S ribosomal protein S3| Length = 243 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS3_HUMAN (P23396) 40S ribosomal protein S3| Length = 243 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS3_BOVIN (Q3T169) 40S ribosomal protein S3| Length = 243 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS3_AMBME (P79891) 40S ribosomal protein S3| Length = 253 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS32_XENLA (P47835) 40S ribosomal protein S3-B (S1B)| Length = 246 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>RS31_XENLA (P02350) 40S ribosomal protein S3-A (S1A)| Length = 246 Score = 28.9 bits (63), Expect = 3.3 Identities = 12/20 (60%), Positives = 15/20 (75%) Frame = -2 Query: 337 KLGPTTPLPDLVTIHPPKEE 278 K+GP PLPD V+I PK+E Sbjct: 197 KIGPKKPLPDHVSIVEPKDE 216
>MLL2_HUMAN (O14686) Myeloid/lymphoid or mixed-lineage leukemia protein 2| (ALL1-related protein) Length = 5262 Score = 28.5 bits (62), Expect = 4.3 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 322 TPLPDLVTIHPPKEEDELRPPAL 254 +PLP + + PP EE L PPAL Sbjct: 654 SPLPVVSRLSPPPEESPLSPPAL 676 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -2 Query: 328 PTTPLPDLVTIHPPKEEDELRPP 260 PT+P P+ + PP EE + PP Sbjct: 562 PTSPPPEASRLSPPPEESPMSPP 584
>SSRP_BACCR (Q815L5) SsrA-binding protein| Length = 155 Score = 28.5 bits (62), Expect = 4.3 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +2 Query: 98 WQHNIEALHINFCKEGNQTLHSPLVTR 178 W HN +HIN ++GN+ H PL TR Sbjct: 59 WVHN---MHINTYEQGNRFNHDPLRTR 82
>RENI2_MOUSE (P00796) Renin-2 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Submandibular gland renin) [Contains: Renin-2 heavy chain; Renin-2 light chain] Length = 401 Score = 28.1 bits (61), Expect = 5.7 Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 7/53 (13%) Frame = -3 Query: 237 PVVQADHETAHHFG-------PSLFPILVTSGLCNVWLPSLQKFMCNASMLCC 100 PVV ++ + ++G P F ++ +G N+W+PS + C+ L C Sbjct: 72 PVVLTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTK---CSRLYLAC 121
>RENI1_MOUSE (P06281) Renin-1 precursor (EC 3.4.23.15) (Angiotensinogenase)| (Kidney renin) Length = 402 Score = 27.7 bits (60), Expect = 7.4 Identities = 14/53 (26%), Positives = 25/53 (47%), Gaps = 7/53 (13%) Frame = -3 Query: 237 PVVQADHETAHHFG-------PSLFPILVTSGLCNVWLPSLQKFMCNASMLCC 100 PVV ++ ++G P F ++ +G N+W+PS + C+ L C Sbjct: 73 PVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTK---CSRLYLAC 122
>OPSD_DICLA (Q9YGZ4) Rhodopsin| Length = 353 Score = 27.7 bits (60), Expect = 7.4 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 7/49 (14%) Frame = -1 Query: 128 LCVMLLCYAAILISFKLSLLRQDTSYVCQRT-------IVWIGSASLVC 3 +CV+ CY +L + K + Q S QR +V +G A L+C Sbjct: 216 MCVVFFCYGRLLCAVKEAAAAQQESETTQRAEKEVTRMVVIMGIAFLIC 264
>DCR1_CAEEL (P34529) Endoribonuclease dcr-1 (EC 3.1.26.-)| Length = 1845 Score = 27.3 bits (59), Expect = 9.7 Identities = 19/64 (29%), Positives = 30/64 (46%), Gaps = 13/64 (20%) Frame = -1 Query: 230 CKQTMKRHIILVLA--CFLSL*QVGYATFGYLPYKSLCVMLL--C---------YAAILI 90 C Q MKRH ++V+ C L L YL + +CV++ C Y +I++ Sbjct: 108 CDQFMKRHHVVVITAQCLLDL-----IRHAYLKIEDMCVLIFDECHHALGSQHPYRSIMV 162 Query: 89 SFKL 78 +KL Sbjct: 163 DYKL 166
>BLNK_CHICK (Q9YGC1) B-cell linker protein (Cytoplasmic adapter protein)| (B-cell adapter SH2 domain-containing protein) Length = 552 Score = 27.3 bits (59), Expect = 9.7 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 5/44 (11%) Frame = -2 Query: 328 PTTPLPDLVT-----IHPPKEEDELRPPALIEV*TPSSASRP*N 212 PT P P L + P+EE+EL PP + P A+R N Sbjct: 234 PTPPKPSLASDMQEVYEVPEEEEELSPPPVTRFTKPLPATRAQN 277 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,339,461 Number of Sequences: 219361 Number of extensions: 774026 Number of successful extensions: 2026 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 1979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2026 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
