ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast14e08 |
|---|---|
| Clone Library Name | barley_pub |
>C71E1_SORBI (O48958) Cytochrome P450 71E1 (EC 1.14.13.68)| (4-hydroxyphenylacetaldehyde oxime monooxygenase) Length = 531 Score = 73.9 bits (180), Expect = 9e-14 Identities = 32/53 (60%), Positives = 40/53 (75%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 MG N F L+NLLYC++WALP M+ EDV +EE G LTF +K PLV+VPT+Y Sbjct: 473 MGETNVTFTLANLLYCYDWALPGAMKPEDVSMEETGALTFHRKTPLVVVPTKY 525
>C71BV_ARATH (Q9LIP6) Cytochrome P450 71B34 (EC 1.14.-.-)| Length = 500 Score = 63.2 bits (152), Expect = 2e-10 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 MG EF L+NLLY F+W LP+GM+ +D+ +EE GLT KK L+LVPT++ Sbjct: 445 MGTTMVEFGLANLLYHFDWKLPEGMKVDDIDMEEAPGLTVNKKNELILVPTKF 497
>C71BQ_ARATH (Q9LTL0) Cytochrome P450 71B26 (EC 1.14.-.-)| Length = 500 Score = 61.2 bits (147), Expect = 6e-10 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 MG EF L+N+LY F+W LP+GM ED+ +EE GLT KK LVLVP +Y Sbjct: 445 MGTTMVEFGLANMLYHFDWKLPEGMVVEDIDMEEAPGLTVSKKSELVLVPVKY 497
>C71BY_ARATH (Q9LIP3) Cytochrome P450 71B37 (EC 1.14.-.-)| Length = 500 Score = 59.3 bits (142), Expect = 2e-09 Identities = 29/53 (54%), Positives = 35/53 (66%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 MG EF L+NLLY F+W LP+GM ED+ +EE GL KK LVLVP +Y Sbjct: 445 MGTTMVEFGLANLLYHFDWKLPEGMVVEDIDMEESPGLNASKKNELVLVPRKY 497
>C71BK_ARATH (Q9LTM3) Cytochrome P450 71B20 (EC 1.14.-.-)| Length = 502 Score = 58.2 bits (139), Expect = 5e-09 Identities = 29/52 (55%), Positives = 33/52 (63%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 MG+A E L NLLY F+W LP GM +D+ EE G LT KK PL LVP R Sbjct: 449 MGIAAVELGLLNLLYFFDWKLPDGMTHKDIDTEEAGTLTIVKKVPLQLVPVR 500
>C71BJ_ARATH (Q9LTM4) Cytochrome P450 71B19 (EC 1.14.-.-)| Length = 502 Score = 58.2 bits (139), Expect = 5e-09 Identities = 29/52 (55%), Positives = 33/52 (63%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 MG+A E L NLLY F+W LP GM +D+ EE G LT KK PL LVP R Sbjct: 449 MGIAAVELGLLNLLYFFDWKLPDGMTHKDIDTEEAGTLTIVKKVPLKLVPVR 500
>C71B2_ARATH (O65788) Cytochrome P450 71B2 (EC 1.14.-.-)| Length = 502 Score = 58.2 bits (139), Expect = 5e-09 Identities = 25/54 (46%), Positives = 36/54 (66%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYY 209 M +A+ E L NLLY F+W++P G + ED+ +EE G ++ KK PL LVP + Y Sbjct: 449 MAIASVELALMNLLYYFDWSMPDGTKGEDIDMEEAGNISIVKKIPLQLVPVQRY 502
>C71BA_ARATH (Q9LVD2) Cytochrome P450 71B10 (EC 1.14.-.-)| Length = 502 Score = 57.8 bits (138), Expect = 6e-09 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 MG+ EF L+NLLY F+W LP+G+ ED+ ++E GLT KK L+LVP + Sbjct: 448 MGITTVEFGLANLLYHFDWKLPEGVAVEDIYMDEASGLTSHKKHDLLLVPVK 499
>C71BX_ARATH (Q9LIP4) Cytochrome P450 71B36 (EC 1.14.-.-)| Length = 500 Score = 57.4 bits (137), Expect = 8e-09 Identities = 27/53 (50%), Positives = 35/53 (66%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 MG EF L+N+LY F+W +P GM +ED+ +EE GL KK LVLVP +Y Sbjct: 445 MGTTMVEFGLANMLYHFDWKIPVGMVAEDIDLEESPGLNASKKNELVLVPLKY 497
>C71BW_ARATH (Q9LIP5) Cytochrome P450 71B35 (EC 1.14.-.-)| Length = 500 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/50 (54%), Positives = 34/50 (68%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 MG EF L+NLLY F+W LP+G+ +D+ VEE GLT KK L+LVP Sbjct: 444 MGTTMVEFGLANLLYHFDWKLPEGVEVKDIDVEEAPGLTVNKKNELLLVP 493
>C71B9_ARATH (O64718) Cytochrome P450 71B9 (EC 1.14.-.-)| Length = 500 Score = 55.8 bits (133), Expect = 2e-08 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 MG EF L+N+LY F+W +P GM ED+ +EE GL KK L+LVP +Y Sbjct: 445 MGTTMVEFGLANMLYQFDWEVPDGMVVEDIDMEESPGLAVGKKNELLLVPVKY 497
>C71B8_ARATH (P58048) Cytochrome P450 71B8 (EC 1.14.-.-)| Length = 506 Score = 55.5 bits (132), Expect = 3e-08 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +G+ E L N+LY F+W+LP GM +D+ +EE G LT KK PL L+PT Sbjct: 448 LGITILELGLLNILYYFDWSLPNGMTIKDIDMEEDGALTIAKKVPLELIPT 498
>C83B1_ARATH (O65782) Cytochrome P450 83B1 (EC 1.14.-.-)| Length = 499 Score = 55.1 bits (131), Expect = 4e-08 Identities = 23/53 (43%), Positives = 37/53 (69%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 +G+A E +NLLY F+W+LP+G++ ED+ ++ GL KK+ LVL PT++ Sbjct: 446 LGIAMVEIPFANLLYKFDWSLPKGIKPEDIKMDVMTGLAMHKKEHLVLAPTKH 498
>C71DB_LOTJA (O22307) Cytochrome P450 71D11 (EC 1.14.-.-) (Fragment)| Length = 490 Score = 55.1 bits (131), Expect = 4e-08 Identities = 24/54 (44%), Positives = 39/54 (72%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 G+AN E +L+ LLY F+W LP+G+++ED+ + E G+T KK+ L L+P+ +P Sbjct: 433 GMANVELVLALLLYHFDWTLPKGIKNEDLDLTEEFGVTVSKKEDLCLIPSISHP 486
>C71BN_ARATH (Q9LTM0) Cytochrome P450 71B23 (EC 1.14.-.-)| Length = 501 Score = 54.3 bits (129), Expect = 7e-08 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 MG+A E L NLLY F+W LP+G +D+ +EE G + KK L LVPTR Sbjct: 448 MGIATVELGLLNLLYFFDWGLPEGRTVKDIDLEEEGAIIIGKKVSLELVPTR 499
>C71BU_ARATH (Q9SCN2) Cytochrome P450 71B31 (EC 1.14.-.-)| Length = 498 Score = 53.9 bits (128), Expect = 9e-08 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +G+ E L N+LY F+W+LP GM +D+ +EE G L KK PL LVPT Sbjct: 446 LGITILELGLLNILYYFDWSLPSGMTIKDIDMEEDGALNIAKKVPLQLVPT 496
>C71BH_ARATH (Q9LTM6) Cytochrome P450 71B17 (EC 1.14.-.-)| Length = 502 Score = 53.9 bits (128), Expect = 9e-08 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 MG+A E L NLLY F+W LP GM +D+ EE G LT KK L LVP R Sbjct: 449 MGMATLELGLLNLLYFFDWKLPDGMSHKDIDTEEAGTLTVVKKVHLKLVPVR 500
>C71D9_SOYBN (O81971) Cytochrome P450 71D9 (EC 1.14.-.-) (P450 CP3)| Length = 496 Score = 53.9 bits (128), Expect = 9e-08 Identities = 21/49 (42%), Positives = 36/49 (73%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 G++N E++L+ L+Y F+W LP+G ++ED+G+ E G+T +K L L+P Sbjct: 443 GLSNVEYVLAMLMYHFDWKLPKGTKNEDLGMTEIFGITVARKDDLYLIP 491
>C71BB_ARATH (P58049) Cytochrome P450 71B11 (EC 1.14.-.-)| Length = 496 Score = 53.9 bits (128), Expect = 9e-08 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 MG+A L NLLY F+W LP+GM EDV +EE GL KK PL L+P Sbjct: 441 MGMALVHLTLINLLYRFDWKLPEGMEVEDVDLEESYGLVCPKKVPLQLIP 490
>C71BM_ARATH (Q9LTM1) Cytochrome P450 71B22 (EC 1.14.-.-)| Length = 500 Score = 53.9 bits (128), Expect = 9e-08 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 G+ E L N+LY F+W+LP GM+ ED+ +EE G KK PL L+PT Sbjct: 447 GITIVELGLLNVLYFFDWSLPDGMKIEDIDMEEAGAFVVAKKVPLELIPT 496
>C71BD_ARATH (P58050) Cytochrome P450 71B13 (EC 1.14.-.-)| Length = 496 Score = 53.5 bits (127), Expect = 1e-07 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 MG+A L NLLY F+W LP+GM EDV +EE GL KK PL L+P Sbjct: 441 MGMALIHLTLINLLYRFDWKLPEGMEVEDVDLEESYGLVCPKKVPLELIP 490
>C71BZ_ARATH (Q9LXM3) Cytochrome P450 71B38 (EC 1.14.-.-)| Length = 500 Score = 53.1 bits (126), Expect = 2e-07 Identities = 25/52 (48%), Positives = 32/52 (61%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 G+ E L NLLY F+W+LP GM ED+ +EE G KK PLVL+ T + Sbjct: 447 GITMVELGLLNLLYFFDWSLPNGMTIEDIDMEEDEGFAIAKKVPLVLIQTSH 498
>C71C4_MAIZE (Q43257) Cytochrome P450 71C4 (EC 1.14.-.-) (Benzoxazineless 2)| Length = 538 Score = 52.8 bits (125), Expect = 2e-07 Identities = 24/47 (51%), Positives = 34/47 (72%) Frame = -1 Query: 361 ANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 A E +LSNL+Y F+W LP GM++EDV + E G+T +K+ L+LVP Sbjct: 489 ATIEAMLSNLMYRFDWQLPAGMKAEDVDMTEVFGITVSRKEKLLLVP 535
>C71BE_ARATH (P58051) Cytochrome P450 71B14 (EC 1.14.-.-)| Length = 496 Score = 52.8 bits (125), Expect = 2e-07 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +G+A L NLLY F+W LP+GM EDV +EE GL KK PL L+P Sbjct: 441 LGMALVHLTLINLLYRFDWKLPEGMNIEDVDLEESYGLVCPKKVPLQLIP 490
>C71BG_ARATH (Q9LTM7) Cytochrome P450 71B16 (EC 1.14.-.-)| Length = 502 Score = 52.0 bits (123), Expect = 4e-07 Identities = 26/52 (50%), Positives = 31/52 (59%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 +G+ E L NLLY F+W P GM +D+ EE G LT KK PL LVP R Sbjct: 449 LGITIVELGLLNLLYFFDWRAPDGMTHKDIDTEEAGILTVVKKVPLKLVPVR 500
>C71BC_ARATH (Q9ZU07) Cytochrome P450 71B12 (EC 1.14.-.-)| Length = 496 Score = 52.0 bits (123), Expect = 4e-07 Identities = 26/50 (52%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 MG+A L NLLY F+W LP+GM+ DV +EE GL KK PL L+P Sbjct: 441 MGMALVHLTLINLLYRFDWKLPEGMKVADVDLEESYGLVCPKKIPLQLIP 490
>C71BL_ARATH (Q9LTM2) Cytochrome P450 71B21 (EC 1.14.-.-)| Length = 499 Score = 51.2 bits (121), Expect = 6e-07 Identities = 24/53 (45%), Positives = 31/53 (58%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYY 209 G+ E L N+LY F+W+LP GM D+ +EE G KK PL LVP +Y Sbjct: 447 GMTIVELGLLNVLYFFDWSLPYGMAIADINMEEAGAFVIAKKVPLELVPVLHY 499
>C71B1_THLAR (P49264) Cytochrome P450 71B1 (EC 1.14.-.-) (CYPLXXIB1)| Length = 496 Score = 50.4 bits (119), Expect = 1e-06 Identities = 24/50 (48%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 MG+A L NLLY F+W LP GM++E++ +EE GL KK PL +P Sbjct: 441 MGLAVVHLTLINLLYRFDWKLPNGMKAEELSIEENYGLICVKKLPLEAIP 490
>C99A1_SORBI (O48957) Cytochrome P450 CYP99A1 (EC 1.14.-.-) (Fragment)| Length = 519 Score = 49.7 bits (117), Expect = 2e-06 Identities = 22/52 (42%), Positives = 35/52 (67%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 G+A E +++ LLY F+W+LP GMR E++ ++ G T R++ L LVP+ Y Sbjct: 459 GLAALELMVARLLYYFDWSLPDGMRPEELDMDTVVGSTMRRRNHLHLVPSPY 510
>C71BR_ARATH (Q9SAE1) Cytochrome P450 71B27 (EC 1.14.-.-)| Length = 503 Score = 49.7 bits (117), Expect = 2e-06 Identities = 24/50 (48%), Positives = 31/50 (62%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 M +A E L NLL F+W LP GM+ ED+ +EE G +T KK + LVP Sbjct: 450 MAIATVELGLMNLLDFFDWRLPDGMKVEDIDIEEAGNVTVVKKLLIYLVP 499
>C71D8_SOYBN (O81974) Cytochrome P450 71D8 (EC 1.14.-.-) (P450 CP7)| Length = 504 Score = 49.3 bits (116), Expect = 2e-06 Identities = 23/52 (44%), Positives = 33/52 (63%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 G+A+ L+ LLY FNW LP M+ ED+ ++E G+T +K L L+PT Y Sbjct: 450 GLASITLPLALLLYHFNWELPNKMKPEDLDMDEHFGMTVARKNKLFLIPTVY 501
>C76C2_ARATH (O64637) Cytochrome P450 76C2 (EC 1.14.-.-)| Length = 512 Score = 48.9 bits (115), Expect = 3e-06 Identities = 22/52 (42%), Positives = 32/52 (61%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 + V +L++LLY F+W LP G+ SED+ ++E GLT K PL VP + Sbjct: 456 LAVKTVPLMLASLLYSFDWKLPNGVGSEDLDMDETFGLTLHKTNPLHAVPVK 507
>C71B5_ARATH (O65784) Cytochrome P450 71B5 (EC 1.14.-.-)| Length = 498 Score = 48.9 bits (115), Expect = 3e-06 Identities = 23/50 (46%), Positives = 31/50 (62%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 G+ E L +LLY F+W+LP GM ++D+ +EE G KK L LVPT Sbjct: 445 GITIVELGLLSLLYFFDWSLPNGMTTKDIDMEEDGAFVIAKKVSLELVPT 494
>C76C1_ARATH (O64636) Cytochrome P450 76C1 (EC 1.14.-.-)| Length = 512 Score = 48.5 bits (114), Expect = 4e-06 Identities = 21/52 (40%), Positives = 33/52 (63%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 + + +L++LLY F+W LP+G+ SED+ ++E GLT K PL VP + Sbjct: 455 LAMKTVSLMLASLLYSFDWKLPKGVLSEDLDMDETFGLTLHKTNPLHAVPVK 506
>C71BP_ARATH (Q9LTL2) Cytochrome P450 71B25 (EC 1.14.-.-)| Length = 501 Score = 48.1 bits (113), Expect = 5e-06 Identities = 24/52 (46%), Positives = 33/52 (63%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYY 209 +A E L NLLY F+W LP+ M+ D+ +EE G +T KK PL L+P Y+ Sbjct: 452 IATIELTLLNLLYFFDWKLPEEMK--DMNMEESGDVTIVKKVPLELLPVLYH 501
>C71D7_SOLCH (P93531) Cytochrome P450 71D7 (EC 1.14.-.-)| Length = 500 Score = 47.0 bits (110), Expect = 1e-05 Identities = 22/54 (40%), Positives = 32/54 (59%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 G+AN L+ LLY F+W LP GM +D+ + E G+T +K L L+ T + P Sbjct: 447 GLANVYLPLAQLLYHFDWKLPTGMEPKDLDLTESAGITAARKGDLYLIATPHQP 500
>C71B7_ARATH (Q96514) Cytochrome P450 71B7 (EC 1.14.-.-)| Length = 504 Score = 47.0 bits (110), Expect = 1e-05 Identities = 21/50 (42%), Positives = 29/50 (58%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +G+ E L NLLY F+W +P G +D+ +EE G + KK L LVP Sbjct: 451 LGITTVELGLLNLLYFFDWVVPVGKNVKDINLEETGSIIISKKTTLELVP 500
>C71DA_SOYBN (O48923) Cytochrome P450 71D10 (EC 1.14.-.-)| Length = 510 Score = 46.6 bits (109), Expect = 1e-05 Identities = 20/53 (37%), Positives = 32/53 (60%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 + N E L+ LLY F+W LP M++E++ + E G+T R++ L L+P P Sbjct: 458 IPNIELPLAQLLYHFDWKLPNKMKNEELDMTESNGITLRRQNDLCLIPITRLP 510
>C71B4_ARATH (O65786) Cytochrome P450 71B4 (EC 1.14.-.-)| Length = 504 Score = 45.1 bits (105), Expect = 4e-05 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 M +A E L NLLY F+W +P+ + +D+ +EE G LT KK PL L+P Sbjct: 451 MAIATIELGLLNLLYFFDWNMPE--KKKDMDMEEAGDLTVDKKVPLELLP 498
>C75A6_CAMME (O04773) Flavonoid 3',5'-hydroxylase (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A6) Length = 523 Score = 44.3 bits (103), Expect = 7e-05 Identities = 22/55 (40%), Positives = 33/55 (60%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 MG A+ E+IL L++ F+W LP G+ +V +EE G+ +KK PL + T P Sbjct: 465 MGAASVEYILGTLVHSFDWKLPDGV--VEVNMEESFGIALQKKVPLSAIVTPRLP 517
>C76C4_ARATH (O64635) Cytochrome P450 76C4 (EC 1.14.-.-)| Length = 511 Score = 44.3 bits (103), Expect = 7e-05 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 + V +L++LLY F+W LP G+ SED+ ++E G+T + L +P + Sbjct: 455 LAVKTVSLMLASLLYSFDWKLPNGVVSEDLDMDETFGITLHRTNTLYAIPVK 506
>C71B6_ARATH (O65787) Cytochrome P450 71B6 (EC 1.14.-.-)| Length = 503 Score = 44.3 bits (103), Expect = 7e-05 Identities = 23/50 (46%), Positives = 32/50 (64%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +G++ E+ L+NLLY F+W +E+V VEE GLT +K PL LVP Sbjct: 451 VGLSTVEYTLANLLYHFDWKA-----TEEVSVEEAPGLTSHRKHPLHLVP 495
>C71BO_ARATH (Q9LTL8) Cytochrome P450 71B24 (EC 1.14.-.-)| Length = 498 Score = 44.3 bits (103), Expect = 7e-05 Identities = 23/52 (44%), Positives = 32/52 (61%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYY 209 +A E L NLLY F+W LP+ +D+ +EE G +T KK PL LVP ++ Sbjct: 449 IATVELGLLNLLYHFDWRLPE--EDKDLDMEEAGDVTIIKKVPLKLVPVLHH 498
>C71A6_NEPRA (O04164) Cytochrome P450 71A6 (EC 1.14.-.-) (Fragment)| Length = 511 Score = 43.9 bits (102), Expect = 1e-04 Identities = 20/45 (44%), Positives = 30/45 (66%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 E L+ L++ F++ LP G+R ED+ + E G T KK PL++VPT Sbjct: 461 ELALATLVHKFDFKLPNGVRVEDLDMSEGSGFTIHKKFPLLVVPT 505
>C71D6_SOLCH (P93530) Cytochrome P450 71D6 (EC 1.14.-.-)| Length = 501 Score = 43.9 bits (102), Expect = 1e-04 Identities = 21/54 (38%), Positives = 30/54 (55%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 G+AN L+ LL F+W LP GM +D+ + E G++ K L L+ T Y P Sbjct: 448 GLANDYLPLAQLLCHFDWKLPTGMEPKDLDLTELAGMSAASKDDLYLIATPYQP 501
>C71A2_SOLME (P37118) Cytochrome P450 71A2 (EC 1.14.-.-) (CYPLXXIA2) (P-450EG4)| Length = 505 Score = 43.5 bits (101), Expect = 1e-04 Identities = 20/49 (40%), Positives = 35/49 (71%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +A E L+ L++ F++ALP+G++ ED+ + E G+T R+K PL++V T Sbjct: 455 IAVIELALARLVHKFDFALPEGIKPEDLDMTETIGITTRRKLPLLVVAT 503
>C71A4_SOLME (P37117) Cytochrome P450 71A4 (EC 1.14.-.-) (CYPLXXIA4) (P-450EG2)| Length = 507 Score = 43.1 bits (100), Expect = 2e-04 Identities = 20/51 (39%), Positives = 33/51 (64%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 +A E L+ L++ FN+ALP+G + ED+ + E G+ R+K PL +V T + Sbjct: 455 IAVIELALARLVHKFNFALPKGTKPEDLDMTECTGIATRRKSPLPVVATPF 505
>C71B3_ARATH (O65785) Cytochrome P450 71B3 (EC 1.14.-.-)| Length = 501 Score = 43.1 bits (100), Expect = 2e-04 Identities = 23/49 (46%), Positives = 29/49 (59%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 G+A E L NLLY F+W L + +D+ +EE G T KK PL LVP Sbjct: 451 GIATVELGLLNLLYYFDWRLAE--EDKDIDMEEAGDATIVKKVPLELVP 497
>C83A1_ARATH (P48421) Cytochrome P450 83A1 (EC 1.14.-.-) (CYPLXXXIII)| Length = 502 Score = 42.7 bits (99), Expect = 2e-04 Identities = 20/52 (38%), Positives = 30/52 (57%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 +G A E +NLL FN+ LP GM+ +D+ ++ GL K + L LVP + Sbjct: 447 LGAAMLEVPYANLLLSFNFKLPNGMKPDDINMDVMTGLAMHKSQHLKLVPEK 498
>C71C2_MAIZE (Q43255) Cytochrome P450 71C2 (EC 1.14.-.-) (Benzoxazineless 3)| Length = 536 Score = 42.7 bits (99), Expect = 2e-04 Identities = 22/49 (44%), Positives = 31/49 (63%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 G A E +L+NL+Y F+W +P V +EE GLT R+K+ L+LVP Sbjct: 486 GFATMEVMLANLMYHFDWEVPGS--GAGVSMEESFGLTLRRKEKLLLVP 532
>C76A1_SOLME (P37121) Cytochrome P450 76A1 (EC 1.14.-.-) (CYPLXXVIA1) (P-450EG8)| (Fragment) Length = 467 Score = 42.4 bits (98), Expect = 3e-04 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 +G F +LL+ F+W LP + + + +EE G+T RKK+PL ++P + Sbjct: 415 LGHRMMHFTFGSLLHEFDWELPHNVSPKSINMEESMGITARKKQPLKVIPKK 466
>C84A1_ARATH (Q42600) Cytochrome P450 84A1 (EC 1.14.-.-)| (Ferulate-5-hydroxylase) (F5H) Length = 520 Score = 41.2 bits (95), Expect = 6e-04 Identities = 17/51 (33%), Positives = 30/51 (58%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +G+ + ++++L+CF W LP GM+ ++ + + GLT K L VPT Sbjct: 463 LGLYALDLAVAHILHCFTWKLPDGMKPSELDMNDVFGLTAPKATRLFAVPT 513
>C71A9_SOYBN (O81970) Cytochrome P450 71A9 (EC 1.14.-.-) (P450 CP1)| Length = 499 Score = 40.8 bits (94), Expect = 8e-04 Identities = 20/47 (42%), Positives = 29/47 (61%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 E L+NLL+ F+W LP G+ +D+ +EE G+T KK L L T + Sbjct: 451 ELALANLLFRFDWELPLGLGIQDLDMEEAIGITIHKKAHLWLKATPF 497
>F3PH_PETHY (Q9SBQ9) Flavonoid 3'-monooxygenase (EC 1.14.13.21) (Flavonoid| 3'-hydroxylase) (Cytochrome P450 75B2) Length = 512 Score = 40.4 bits (93), Expect = 0.001 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +G+ + +++ L++ FNW L G E + +EE GLT ++ PLV+ P Sbjct: 452 LGIRMVQLMIATLIHAFNWDLVSGQLPEMLNMEEAYGLTLQRADPLVVHP 501
>C75A2_SOLME (P37120) Flavonoid 3',5'-hydroxylase (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A2) (CYPLXXVA2) (P-450EG1) Length = 513 Score = 39.3 bits (90), Expect = 0.002 Identities = 19/51 (37%), Positives = 29/51 (56%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 MG+ E+IL L++ F+W LP + D+ +EE GL +K PL + T Sbjct: 451 MGIVMVEYILGTLIHSFDWKLPNDV--VDINMEETFGLALQKAVPLEAIVT 499
>C76C3_ARATH (O64638) Cytochrome P450 76C3 (EC 1.14.-.-)| Length = 515 Score = 39.3 bits (90), Expect = 0.002 Identities = 18/52 (34%), Positives = 28/52 (53%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 M + +L++LLY F+W L G+ ++ + E GLT K K L VP + Sbjct: 456 MALKTMHMVLASLLYSFDWKLQNGVVPGNIDMSETFGLTLHKAKSLCAVPVK 507
>F3PH_ARATH (Q9SD85) Flavonoid 3'-monooxygenase (EC 1.14.13.21) (Flavonoid| 3'-hydroxylase) (AtF3'H) (Cytochrome P450 75B1) (TRANSPARENT TESTA 7 protein) Length = 513 Score = 38.1 bits (87), Expect = 0.005 Identities = 17/50 (34%), Positives = 30/50 (60%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +G+ +F+ + L+ F+W L G+ E + +EE GLT ++ PLV+ P Sbjct: 450 LGLRTIQFLTATLVQGFDWELAGGVTPEKLNMEESYGLTLQRAVPLVVHP 499
>C71C1_MAIZE (Q43250) Cytochrome P450 71C1 (EC 1.14.-.-) (Benzoxazineless 4)| Length = 535 Score = 37.0 bits (84), Expect = 0.012 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMR--SEDVGVEEFGGLTFRKKKPLVLVP 221 +A E +L+NL+Y F+W +P M V + + G+T R+ + L LVP Sbjct: 477 IATVEIMLANLIYHFDWEMPAEMERTGAKVDMSDQFGMTLRRTQKLYLVP 526
>C71C3_MAIZE (P93703) Cytochrome P450 71C3 (EC 1.14.-.-) (Benzoxazineless 5)| Length = 535 Score = 36.6 bits (83), Expect = 0.015 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 4/53 (7%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALPQGMRSED----VGVEEFGGLTFRKKKPLVLVP 221 G+A E +L+NL+Y F+W +P ED V ++E GL R+ + L LVP Sbjct: 481 GLATMEIMLANLMYHFDWEVPN--EKEDGCWKVSMDEKFGLMLRRNELLYLVP 531
>C80A1_BERST (P47195) Berbamunine synthase (EC 1.14.21.3) (Cytochrome P450 80)| (CYPLXXX) ((S)-N-methylcoclaurine oxidase [C-O phenol-coupling]) Length = 487 Score = 36.6 bits (83), Expect = 0.015 Identities = 15/42 (35%), Positives = 27/42 (64%) Frame = -1 Query: 346 ILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +L++L++ F W LP G+ +E + +EE L+ KPL ++P Sbjct: 442 VLASLVHAFGWELPDGVPNEKLDMEELFTLSLCMAKPLRVIP 483
>C80B2_ESCCA (O64900) (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 (EC| 1.14.13.71) (Cytochrome P450 80B2) Length = 488 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = -1 Query: 346 ILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +++ + +W LP GM + + VEE GLT +K+ PL +VP Sbjct: 443 LVATFVQNLDWCLPNGMSVDHLIVEEKFGLTLQKEPPLFIVP 484
>C80B1_ESCCA (O64899) (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (EC| 1.14.13.71) (Cytochrome P450 80B1) (Fragment) Length = 487 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/42 (38%), Positives = 26/42 (61%) Frame = -1 Query: 346 ILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +++ + +W LP GM + + VEE GLT +K+ PL +VP Sbjct: 442 LVATFVQNLDWCLPNGMSVDHLIVEEKFGLTLQKEPPLFIVP 483
>C98A1_SORBI (O48956) Cytochrome P450 98A1 (EC 1.14.-.-)| Length = 512 Score = 36.2 bits (82), Expect = 0.020 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLV 224 +G+ ++ +LL+ F W+LP+G R EDV + E GL PL V Sbjct: 446 LGINLVASMIGHLLHHFEWSLPEGTRPEDVNMMESPGLVTFMGTPLQAV 494
>C71AP_ARATH (Q9STK8) Cytochrome P450 71A25 (EC 1.14.-.-)| Length = 490 Score = 36.2 bits (82), Expect = 0.020 Identities = 16/51 (31%), Positives = 28/51 (54%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRY 212 V E +L+NL++ F+W LP+ + + V E G + ++ PL V + Y Sbjct: 438 VVLNEVVLANLVHGFDWKLPEESKEDKTDVAESSGFSVHREFPLYAVASPY 488
>C75A3_PETHY (P48419) Flavonoid 3',5'-hydroxylase 2 (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A3) (CYPLXXVA3) Length = 508 Score = 35.8 bits (81), Expect = 0.026 Identities = 19/55 (34%), Positives = 30/55 (54%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 MG+ E+IL L++ F+W LP + ++ +EE GL +K PL + T P Sbjct: 448 MGIVMVEYILGTLVHSFDWKLPSEV--IELNMEEAFGLALQKAVPLEAMVTPRLP 500
>C76A2_SOLME (P37122) Cytochrome P450 76A2 (EC 1.14.-.-) (CYPLXXVIA2) (P-450EG7)| Length = 505 Score = 35.0 bits (79), Expect = 0.045 Identities = 16/52 (30%), Positives = 28/52 (53%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 +G F L +LL F W LP G+ + + ++ G+T RK+ L ++P + Sbjct: 453 LGHRMMHFALGSLLREFEWELPDGVSPKSINMDGSMGVTARKRDSLKVIPKK 504
>C75A1_PETHY (P48418) Flavonoid 3',5'-hydroxylase 1 (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A1) (CYPLXXVA1) Length = 506 Score = 35.0 bits (79), Expect = 0.045 Identities = 18/51 (35%), Positives = 29/51 (56%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 MG+ E+IL L++ F+W LP + ++ +EE GL +K PL + T Sbjct: 448 MGIVMVEYILGTLVHSFDWKLPSEV--IELNMEEAFGLALQKAVPLEAMVT 496
>C98A3_ARATH (O22203) Cytochrome P450 98A3 (EC 1.14.-.-)| Length = 508 Score = 34.7 bits (78), Expect = 0.058 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 +G+ ++S+LL+ F W PQG + E++ + E GL + P+ V T P Sbjct: 443 LGINLVTSMMSHLLHHFVWTPPQGTKPEEIDMSENPGLVTYMRTPVQAVATPRLP 497
>C75A4_GENTR (Q96581) Flavonoid 3',5'-hydroxylase (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A4) Length = 516 Score = 34.3 bits (77), Expect = 0.076 Identities = 16/46 (34%), Positives = 27/46 (58%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPL 233 MG+ E+IL L++ F+W L G +++ ++E GL +K PL Sbjct: 458 MGILLVEYILGTLVHSFDWKL--GFSEDELNMDETFGLALQKAVPL 501
>C71A8_MENPI (Q42716) Cytochrome P450 71A8 (EC 1.14.-.-)| Length = 502 Score = 33.9 bits (76), Expect = 0.099 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 +A EF L+NL+ F+W LP R D + E G+ R+ PL+ + T+ Sbjct: 454 MATLEFTLANLMQKFDWELPHECRELD--MSERPGVAIRRVIPLLAIGTK 501
>C75A5_EUSGR (Q96418) Flavonoid 3',5'-hydroxylase (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A5) Length = 510 Score = 33.5 bits (75), Expect = 0.13 Identities = 17/55 (30%), Positives = 30/55 (54%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 +G+ E+IL L++ F+W LP + ++ ++E GL +K PL + T P Sbjct: 452 LGILLVEYILGTLVHSFDWELPSSV--IELNMDEPFGLALQKAVPLAAMVTPRLP 504
>C71BT_ARATH (Q9SAE4) Cytochrome P450 71B29 (EC 1.14.-.-)| Length = 490 Score = 33.1 bits (74), Expect = 0.17 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDV 281 MG+ EF L NLLY F+W LP+ ++ + Sbjct: 445 MGITLVEFALLNLLYFFDWGLPEKEEADKI 474
>C75A7_EUSGR (O04790) Flavonoid 3',5'-hydroxylase (EC 1.14.13.88) (F3'5'H)| (Cytochrome P450 75A7) Length = 510 Score = 32.7 bits (73), Expect = 0.22 Identities = 17/55 (30%), Positives = 29/55 (52%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 +G+ E+IL L++ F W LP + ++ ++E GL +K PL + T P Sbjct: 452 LGILLVEYILGTLVHSFVWELPSSV--IELNMDESFGLALQKAVPLAAMVTPRLP 504
>C98A2_SOYBN (O48922) Cytochrome P450 98A2 (EC 1.14.-.-)| Length = 509 Score = 32.7 bits (73), Expect = 0.22 Identities = 16/55 (29%), Positives = 29/55 (52%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTRYYP 206 +G+ +L +LL+ F W P+GM+ E++ + E GL + P+ V + P Sbjct: 444 LGINLAASMLGHLLHHFCWTPPEGMKPEEIDMGENPGLVTYMRTPIQAVVSPRLP 498
>C71A1_PERAE (P24465) Cytochrome P450 71A1 (EC 1.14.-.-) (CYPLXXIA1) (ARP-2)| Length = 471 Score = 32.0 bits (71), Expect = 0.38 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 367 GVANTEFILSNLLYCFNWALP 305 G+++ E L+NLLY FNW LP Sbjct: 449 GISSVEISLANLLYWFNWELP 469
>C71BS_ARATH (Q9SAE3) Cytochrome P450 71B28 (EC 1.14.-.-)| Length = 490 Score = 32.0 bits (71), Expect = 0.38 Identities = 13/30 (43%), Positives = 20/30 (66%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDV 281 MG+A E L NLLY F+W LP+ ++++ Sbjct: 445 MGIAIVELGLLNLLYFFDWGLPEKEEAKEI 474
>C71AF_ARATH (P58046) Cytochrome P450 71A15 (EC 1.14.-.-)| Length = 496 Score = 31.2 bits (69), Expect = 0.64 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +A E L+NL+ FNW + + ++ + E G+ +K PL++ P+ Sbjct: 446 MALVEVTLANLVNRFNWRMDARLSGDEYDLAEATGIDVCRKFPLIVFPS 494
>C71AO_ARATH (Q9STK9) Cytochrome P450 71A24 (EC 1.14.-.-)| Length = 486 Score = 31.2 bits (69), Expect = 0.64 Identities = 14/45 (31%), Positives = 23/45 (51%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 E +L+NL++ F+W LP+ V E G+ + PL + T Sbjct: 442 EVVLANLVHQFDWTLPEESTEYQTDVAESTGMAVHRMFPLFAMTT 486
>C78AB_ORYSA (Q7Y1V5) Cytochrome P450 78A11 (EC 1.14.-.-) (PLASTOCHRON1 protein)| Length = 555 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/51 (31%), Positives = 26/51 (50%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +G+A ++ L++ F+W LP G S V ++E L+ K PL T Sbjct: 500 LGLATVTLWVARLVHAFDWFLPDG--SPPVSLDEVLKLSLEMKTPLAAAAT 548
>C93A2_SOYBN (Q42799) Cytochrome P450 93A2 (EC 1.14.-.-)| Length = 502 Score = 30.0 bits (66), Expect = 1.4 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -1 Query: 343 LSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 L+ ++ CF W G + V +EE G+T + P++ VP Sbjct: 454 LAIMIQCFQWKFDNG--NNKVDMEEKSGITLPRAHPIICVP 492
>C93A1_SOYBN (Q42798) Cytochrome P450 93A1 (EC 1.14.-.-)| Length = 509 Score = 30.0 bits (66), Expect = 1.4 Identities = 14/41 (34%), Positives = 23/41 (56%) Frame = -1 Query: 343 LSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 L+ ++ CF W L G + V +EE G+T + P++ VP Sbjct: 461 LAIIIQCFQWKLVGG--NGKVDMEEKSGITLPRANPIICVP 499
>C71AE_ARATH (P58045) Cytochrome P450 71A14 (EC 1.14.-.-)| Length = 497 Score = 30.0 bits (66), Expect = 1.4 Identities = 15/49 (30%), Positives = 26/49 (53%) Frame = -1 Query: 364 VANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 +A E L+NL+ FNW + ++ + E GL +K PL++ P+ Sbjct: 447 MALVEVTLANLVNRFNWRMEVQHSGDEYDLAESTGLDVCRKFPLIVFPS 495
>VIAAT_RAT (O35458) Vesicular inhibitory amino acid transporter (GABA and| glycine transporter) (Vesicular GABA transporter) (rGVAT) (Solute carrier family 32 member 1) Length = 525 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = -3 Query: 308 PSGDEERGCGRGGVWGPH-FPEEEATRAGANTLLPRQGGEVVFSICFSLNKNKRAAYLLS 132 PSG +++ G GG +G H P+ A AG N QG V+ L+ +L+ Sbjct: 94 PSGSKDQAVGAGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLII 153 Query: 131 PSTLICCVISSLYV 90 + ++CC + + Sbjct: 154 FAAVVCCYTGKILI 167
>VIAAT_MOUSE (O35633) Vesicular inhibitory amino acid transporter (GABA and| glycine transporter) (Vesicular GABA transporter) (mVIAAT) (mVGAT) (Solute carrier family 32 member 1) Length = 525 Score = 30.0 bits (66), Expect = 1.4 Identities = 20/74 (27%), Positives = 34/74 (45%), Gaps = 1/74 (1%) Frame = -3 Query: 308 PSGDEERGCGRGGVWGPH-FPEEEATRAGANTLLPRQGGEVVFSICFSLNKNKRAAYLLS 132 PSG +++ G GG +G H P+ A AG N QG V+ L+ +L+ Sbjct: 94 PSGSKDQAVGAGGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLII 153 Query: 131 PSTLICCVISSLYV 90 + ++CC + + Sbjct: 154 FAAVVCCYTGKILI 167
>RS10C_ARATH (Q9LTF2) 40S ribosomal protein S10-3| Length = 179 Score = 29.6 bits (65), Expect = 1.9 Identities = 17/41 (41%), Positives = 19/41 (46%) Frame = -3 Query: 314 GAPSGDEERGCGRGGVWGPHFPEEEATRAGANTLLPRQGGE 192 G P GD RG G P F + + RAG PR GGE Sbjct: 103 GGPPGDRSRGPRHEGGDRPRFGDRDGYRAG-----PRAGGE 138
>C71AI_ARATH (Q9SAB6) Cytochrome P450 71A18 (EC 1.14.-.-)| Length = 497 Score = 29.6 bits (65), Expect = 1.9 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPT 218 E L+NL+ F+W++ G + + E GL +K PL+ P+ Sbjct: 450 EVTLANLVGRFDWSVDPGPNGDQPDLAEDFGLDVCRKNPLIAFPS 494
>FOXGB_HUMAN (P55315) Forkhead box protein G1B (Forkhead-related protein FKHL1)| (Transcription factor BF-1) (Brain factor 1) (BF1) (HFK1) Length = 477 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/39 (41%), Positives = 20/39 (51%) Frame = -3 Query: 308 PSGDEERGCGRGGVWGPHFPEEEATRAGANTLLPRQGGE 192 PSG + GC R G GP P+E+ AGA + GE Sbjct: 111 PSGAKAGGCCRPGELGPVGPDEKEKGAGAGGEEKKGAGE 149
>C93A3_SOYBN (O81973) Cytochrome P450 93A3 (EC 1.14.-.-) (P450 CP5)| Length = 510 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = -1 Query: 343 LSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVPTR 215 L+ L+ CF W + + V +EE G+T + P++ VP R Sbjct: 462 LAVLIQCFQWKVD--CDNGKVNMEEKAGITLPRAHPIICVPIR 502
>ERG1_SCHPO (Q9C1W3) Probable squalene monooxygenase (EC 1.14.99.7) (Squalene| epoxidase) (SE) Length = 457 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/46 (30%), Positives = 22/46 (47%) Frame = -3 Query: 251 PEEEATRAGANTLLPRQGGEVVFSICFSLNKNKRAAYLLSPSTLIC 114 P T A N LL + GEV+ + S K++ +P T++C Sbjct: 121 PNVTVTEATVNELLRDETGEVITGVVTSSKKSESPVEYKAPLTIVC 166
>ZBT12_HUMAN (Q9Y330) Zinc finger and BTB domain-containing protein 12 (Protein| G10) Length = 459 Score = 28.5 bits (62), Expect = 4.2 Identities = 19/58 (32%), Positives = 26/58 (44%) Frame = -3 Query: 308 PSGDEERGCGRGGVWGPHFPEEEATRAGANTLLPRQGGEVVFSICFSLNKNKRAAYLL 135 P G G G GG G H E + +T+ P QG V C+SL+++ LL Sbjct: 225 PPGGLGGGLGIGGSVGGHLGELAQSSVPPSTVAPPQG---VVKACYSLSEDAEGEGLL 279
>C76B1_HELTU (O23976) Cytochrome P450 76B1 (EC 1.14.-.-) (7-ethoxycoumarin| O-deethylase) (ECOD) (Phenylurea dealkylase) Length = 490 Score = 28.5 bits (62), Expect = 4.2 Identities = 14/42 (33%), Positives = 23/42 (54%) Frame = -1 Query: 346 ILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLVP 221 +L +LL F+W + + + + + E G T K KPL +VP Sbjct: 445 MLGSLLNNFDWKIDTKVPYDVLDMTEKNGTTISKAKPLCVVP 486
>C71AM_ARATH (Q9STL1) Cytochrome P450 71A22 (EC 1.14.-.-)| Length = 490 Score = 28.5 bits (62), Expect = 4.2 Identities = 12/43 (27%), Positives = 22/43 (51%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLV 224 E L+NL++ ++W LP+ + V E G+ + PL + Sbjct: 443 EVTLANLVHRYDWRLPEEYIEDQTNVAESTGMVIHRLFPLYAI 485
>C71AL_ARATH (Q9STL2) Cytochrome P450 71A21 (EC 1.14.-.-)| Length = 490 Score = 28.5 bits (62), Expect = 4.2 Identities = 11/43 (25%), Positives = 21/43 (48%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLVLV 224 E L+N ++ ++W LP+ + V E G+ + PL + Sbjct: 443 EVALANFVHRYDWKLPEDSKENQTNVAESTGMVIHRLFPLYAI 485
>C78A1_MAIZE (P48420) Cytochrome P450 78A1 (EC 1.14.-.-) (CYPLXXVIII)| Length = 547 Score = 28.5 bits (62), Expect = 4.2 Identities = 15/47 (31%), Positives = 25/47 (53%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDVGVEEFGGLTFRKKKPLV 230 +G+ ++ L++ F WALP G + V ++E L+ K PLV Sbjct: 495 LGLTTVGLWVARLVHAFQWALPDGAAA--VCLDEVLKLSLEMKTPLV 539
>SYFB_SYMTH (Q67QF2) Phenylalanyl-tRNA synthetase beta chain (EC 6.1.1.20)| (Phenylalanine--tRNA ligase beta chain) (PheRS) Length = 892 Score = 28.1 bits (61), Expect = 5.5 Identities = 16/29 (55%), Positives = 16/29 (55%), Gaps = 2/29 (6%) Frame = -3 Query: 344 PVQLALLLQLGAPSGDEERGCGRGG--VW 264 P LA L LGAP DEE G GG VW Sbjct: 445 PADLAADLALGAPESDEEPGEDLGGHPVW 473
>POLG_HRV2 (P04936) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome- Length = 2149 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -3 Query: 260 PHFPEEEATRAGANTLLPRQGGEVVFSICFSLNKNKRAAY 141 P FPE+E + T P Q E V S+C + N R AY Sbjct: 2078 PTFPEDEIFESIRWTKKPSQMHEHVLSLCHLMWHNGRDAY 2117
>MTF7_NEIGO (Q59606) Modification methylase NgoFVII (EC 2.1.1.37)| (Cytosine-specific methyltransferase NgoFVII) (M.NgoFVII) (M.NgoVII) Length = 374 Score = 27.3 bits (59), Expect = 9.3 Identities = 10/15 (66%), Positives = 10/15 (66%) Frame = -3 Query: 281 GRGGVWGPHFPEEEA 237 G GG WG HFPE A Sbjct: 278 GGGGTWGYHFPEPRA 292
>KCNH2_RABIT (Q8WNY2) Potassium voltage-gated channel subfamily H member 2| (Voltage-gated potassium channel subunit Kv11.1) (Ether-a-go-go-related gene potassium channel 1) (ERG1) (RERG) (ra-erg) (Ether-a-go-go-related protein 1) (Eag-related protein 1) Length = 1161 Score = 27.3 bits (59), Expect = 9.3 Identities = 19/65 (29%), Positives = 24/65 (36%), Gaps = 7/65 (10%) Frame = -3 Query: 338 QLALLLQLGAPSGDEERGCGRGG-------VWGPHFPEEEATRAGANTLLPRQGGEVVFS 180 ++ L LG G G GG V G +F T G + P E +FS Sbjct: 584 RIGWLHNLGDQMGKPYNSSGLGGPSIKDKYVTGLYFTFSSLTSVGFGNVSPNTNSEKIFS 643 Query: 179 ICFSL 165 IC L Sbjct: 644 ICVML 648
>RENT1_ARATH (Q9FJR0) Regulator of nonsense transcripts 1 homolog (EC 3.6.1.-)| (ATP-dependent helicase UPF1) Length = 1254 Score = 27.3 bits (59), Expect = 9.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 302 GDEERGCGRGGVWGPHFPEEEATRAGANTLLP 207 G+ G GRG G H P ++AT+ T+ P Sbjct: 1034 GNHGFGAGRGTSVGGHLPHQQATQHNVGTIGP 1065
>C71BF_ARATH (Q9LW27) Cytochrome P450 71B15 (EC 1.14.-.-)| Length = 490 Score = 27.3 bits (59), Expect = 9.3 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -1 Query: 370 MGVANTEFILSNLLYCFNWALPQGMRSEDV--GVEEF 266 MG E L NLLY F+W L + ++++ G E F Sbjct: 445 MGTILVEMALLNLLYFFDWGLAKQEEAKEIINGEENF 481
>ADO_HUMAN (Q06278) Aldehyde oxidase (EC 1.2.3.1)| Length = 1338 Score = 27.3 bits (59), Expect = 9.3 Identities = 15/48 (31%), Positives = 23/48 (47%), Gaps = 1/48 (2%) Frame = -1 Query: 352 EFILSNLLYCFNWALPQGMRS-EDVGVEEFGGLTFRKKKPLVLVPTRY 212 E NL+ C+ + S V VE+F + KKK L +VP ++ Sbjct: 967 EINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKF 1014
>TNR18_MOUSE (O35714) Tumor necrosis factor receptor superfamily member 18| precursor (Glucocorticoid-induced TNFR-related protein) Length = 228 Score = 27.3 bits (59), Expect = 9.3 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 350 VHPVQLALLLQLGAPSGDEERGCGRGGV 267 ++ V + +L LG PS EE GCG G V Sbjct: 7 LYGVSMLCVLDLGQPSVVEEPGCGPGKV 34
>TMKL1_ARATH (P33543) Putative kinase-like protein TMKL1 precursor| Length = 674 Score = 27.3 bits (59), Expect = 9.3 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +1 Query: 130 GESK*AARLFLFKEKHIENTTSPPCLGSSVLAPARVA 240 GESK A F + PCLGSS L+P VA Sbjct: 266 GESKFGAESFEGNSPSLCGLPLKPCLGSSRLSPGAVA 302 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,750,312 Number of Sequences: 219361 Number of extensions: 864697 Number of successful extensions: 2168 Number of sequences better than 10.0: 103 Number of HSP's better than 10.0 without gapping: 2105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2165 length of database: 80,573,946 effective HSP length: 98 effective length of database: 59,076,568 effective search space used: 1417837632 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
