| Clone Name | rbast14d12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUMBL_MOUSE (O08919) Numb-like protein | 29 | 4.3 | 2 | FLGH_RHILO (Q98HD3) Flagellar L-ring protein precursor (Basal bo... | 28 | 7.4 | 3 | I17RC_MOUSE (Q8K4C2) Interleukin-17 receptor C precursor (IL-17 ... | 28 | 7.4 | 4 | FTSW_ENTHR (Q47866) Probable cell division protein ftsW | 28 | 9.7 | 5 | NFYAA_ARATH (Q8LFU0) Nuclear transcription factor Y subunit A-10... | 28 | 9.7 | 6 | ARV1_HUMAN (Q9H2C2) Protein ARV1 (hARV1) | 28 | 9.7 |
|---|
>NUMBL_MOUSE (O08919) Numb-like protein| Length = 604 Score = 29.3 bits (64), Expect = 4.3 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +2 Query: 209 QRQWVVI*DPPTSAPSTQPFMDPFGPF 289 Q+Q + PT AP+ QPF P GPF Sbjct: 439 QQQATSVPPMPTMAPTLQPFSAPVGPF 465
>FLGH_RHILO (Q98HD3) Flagellar L-ring protein precursor (Basal body L-ring| protein) Length = 235 Score = 28.5 bits (62), Expect = 7.4 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +1 Query: 145 LDNDNTKGQGHVQVQQHSKENTETVGGHMRSADVGAEHT 261 L N N G +V+ +++ T+ G +R AD+GAE+T Sbjct: 159 LPNGNLMITGSQEVRVNAELRVLTIAGIVRPADIGAENT 197
>I17RC_MOUSE (Q8K4C2) Interleukin-17 receptor C precursor (IL-17 receptor C)| (IL-17RC) (Interleukin-17 receptor-like protein) (IL-17RL) Length = 674 Score = 28.5 bits (62), Expect = 7.4 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -1 Query: 378 DPQDGVRLIRDLSCEVWCFFVLCVP 304 +PQD R LSC +W VLC+P Sbjct: 26 EPQDTARCSLGLSCHLWDGDVLCLP 50
>FTSW_ENTHR (Q47866) Probable cell division protein ftsW| Length = 397 Score = 28.1 bits (61), Expect = 9.7 Identities = 10/33 (30%), Positives = 22/33 (66%) Frame = -1 Query: 201 LAVLLYLYVPLTFGVVIVEWQERLAIFYNPRIV 103 L + +L++ L++GV+++ + RL + PRI+ Sbjct: 44 LFIRQFLFIILSWGVIVLTYSIRLQVLLKPRII 76
>NFYAA_ARATH (Q8LFU0) Nuclear transcription factor Y subunit A-10 (AtNF-YA-10)| Length = 269 Score = 28.1 bits (61), Expect = 9.7 Identities = 18/56 (32%), Positives = 22/56 (39%) Frame = +1 Query: 169 QGHVQVQQHSKENTETVGGHMRSADVGAEHTAFHGSLRSISCRFPRDTQYKKTPHL 336 QG V Q + T + GG S DV H AF F + Y K PH+ Sbjct: 48 QGVVDKQTSTTLFTFSPGGEKSSRDVPKPHVAFAMQSACFEFGFAQPMMYTKHPHV 103
>ARV1_HUMAN (Q9H2C2) Protein ARV1 (hARV1)| Length = 271 Score = 28.1 bits (61), Expect = 9.7 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = +3 Query: 42 PTFFLCLCRHRNISCAEEKKKLFEDY 119 PT C++R I C +E K+L+ DY Sbjct: 23 PTAASASCQYRCIECNQEAKELYRDY 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,013,854 Number of Sequences: 219361 Number of extensions: 1336949 Number of successful extensions: 3350 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 3264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3350 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2511994855 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)