| Clone Name | rbast14b02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KAT3_ARATH (P92960) Potassium channel KAT3 (AKT4) (AtKC1) (Potas... | 29 | 5.3 | 2 | G6PI_TREPA (O83488) Glucose-6-phosphate isomerase (EC 5.3.1.9) (... | 29 | 6.9 | 3 | DOF53_ARATH (Q84TE9) Dof zinc finger protein DOF5.3 (AtDOF5.3) | 29 | 6.9 | 4 | ASSY_SULAC (Q4J8F1) Argininosuccinate synthase (EC 6.3.4.5) (Cit... | 29 | 6.9 |
|---|
>KAT3_ARATH (P92960) Potassium channel KAT3 (AKT4) (AtKC1) (Potassium channel| TKC) Length = 662 Score = 29.3 bits (64), Expect = 5.3 Identities = 16/48 (33%), Positives = 30/48 (62%), Gaps = 1/48 (2%) Frame = +1 Query: 43 QVQRLI-AKITEQSSIIEHQNTTLSHNRNGRLSQQQRVGEERRVYTHG 183 QVQ + ++ T QS+ + + T+S + NG++ +++R G +RV HG Sbjct: 551 QVQETVQSEETPQSN--DEEIVTVSRHENGQIEERRREGVPKRVIIHG 596
>G6PI_TREPA (O83488) Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)| (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase) (PHI) Length = 535 Score = 28.9 bits (63), Expect = 6.9 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = -3 Query: 102 VLVFDDGGLFRDLSNESLYLYILLSVGLEDHTWF 1 +LV G LSNE ++L GLE HT F Sbjct: 211 ILVSKSGTTLETLSNELFVAHVLRQAGLEPHTQF 244
>DOF53_ARATH (Q84TE9) Dof zinc finger protein DOF5.3 (AtDOF5.3)| Length = 257 Score = 28.9 bits (63), Expect = 6.9 Identities = 16/43 (37%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 14 SSNPT--DNNMYKYNDSLLRSRNNPPSSNTKTPRCLTTEMAGC 136 SSNPT DN+ K + + +R PP + PRC +T C Sbjct: 26 SSNPTPLDNDQKKPSPATAVTRPQPPELALRCPRCDSTNTKFC 68
>ASSY_SULAC (Q4J8F1) Argininosuccinate synthase (EC 6.3.4.5)| (Citrulline--aspartate ligase) Length = 391 Score = 28.9 bits (63), Expect = 6.9 Identities = 11/22 (50%), Positives = 16/22 (72%) Frame = +2 Query: 140 NSKELGRRGEFTPMVTDLTSYN 205 N K LGR+G+F+P ++ SYN Sbjct: 340 NMKILGRKGKFSPFSEEIASYN 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 61,823,238 Number of Sequences: 219361 Number of extensions: 1082330 Number of successful extensions: 3045 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3039 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3072927439 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)