| Clone Name | rbast13h12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NUMBL_MOUSE (O08919) Numb-like protein | 29 | 3.0 | 2 | NIFS_ANASP (P12623) Cysteine desulfurase (EC 2.8.1.7) (Nitrogena... | 28 | 8.8 | 3 | NIFS_ANAAZ (Q43884) Cysteine desulfurase (EC 2.8.1.7) (Nitrogena... | 28 | 8.8 | 4 | NIFS1_ANAVT (Q44507) Cysteine desulfurase 1 (EC 2.8.1.7) (Nitrog... | 28 | 8.8 |
|---|
>NUMBL_MOUSE (O08919) Numb-like protein| Length = 604 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/27 (48%), Positives = 16/27 (59%) Frame = +3 Query: 30 QRQWVVI*DPPTSAPSTQPFMDPFGPF 110 Q+Q + PT AP+ QPF P GPF Sbjct: 439 QQQATSVPPMPTMAPTLQPFSAPVGPF 465
>NIFS_ANASP (P12623) Cysteine desulfurase (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS) Length = 400 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 65 VGAEHTAFHGSLRSISCRFPRDTQYKKTPHLAREITDQ 178 +G +T HGS+R CR+ + Q + + EI ++ Sbjct: 338 MGLPYTTLHGSIRFSLCRYTTEAQIDRVIEVMPEIVER 375
>NIFS_ANAAZ (Q43884) Cysteine desulfurase (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS) Length = 400 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 65 VGAEHTAFHGSLRSISCRFPRDTQYKKTPHLAREITDQ 178 +G +T HGS+R CR+ + Q + + EI ++ Sbjct: 338 MGLPYTTLHGSIRFSLCRYTTEAQIDRVIEVMPEIVER 375
>NIFS1_ANAVT (Q44507) Cysteine desulfurase 1 (EC 2.8.1.7) (Nitrogenase| metalloclusters biosynthesis protein nifS1) Length = 400 Score = 27.7 bits (60), Expect = 8.8 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 65 VGAEHTAFHGSLRSISCRFPRDTQYKKTPHLAREITDQ 178 +G +T HGS+R CR+ + Q + + EI ++ Sbjct: 338 MGLPYTTLHGSIRFSLCRYTTEAQIDRVIEVMPEIVER 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 29,861,114 Number of Sequences: 219361 Number of extensions: 501800 Number of successful extensions: 1281 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1264 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1281 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)