| Clone Name | rbast13f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YICO_ECOLI (P31440) Inner membrane protein yicO | 28 | 6.4 | 2 | ANKS3_RAT (Q5M9H0) Ankyrin repeat and SAM domain-containing prot... | 28 | 8.4 | 3 | ANKS3_MOUSE (Q9CZK6) Ankyrin repeat and SAM domain-containing pr... | 28 | 8.4 | 4 | ANKS3_HUMAN (Q6ZW76) Ankyrin repeat and SAM domain-containing pr... | 28 | 8.4 |
|---|
>YICO_ECOLI (P31440) Inner membrane protein yicO| Length = 470 Score = 28.1 bits (61), Expect = 6.4 Identities = 13/37 (35%), Positives = 21/37 (56%) Frame = -2 Query: 149 LPVVYFAGLDGSMGVFFFLVGTFNSGVEYNNNTTIVM 39 +P+ G+ +G+F L+G N+GV N T+VM Sbjct: 167 IPLSLRIGITSGIGLFIALMGLKNTGVIVANKDTLVM 203
>ANKS3_RAT (Q5M9H0) Ankyrin repeat and SAM domain-containing protein 3| Length = 663 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 37 HMTIVVLLLYSTPELNVPTKKKKTPIL 117 H TIV LLL + +NVPT + +TP++ Sbjct: 81 HDTIVHLLLEAGVSVNVPTPEGQTPLM 107
>ANKS3_MOUSE (Q9CZK6) Ankyrin repeat and SAM domain-containing protein 3| Length = 655 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 37 HMTIVVLLLYSTPELNVPTKKKKTPIL 117 H TIV LLL + +NVPT + +TP++ Sbjct: 81 HDTIVHLLLEAGVSVNVPTPEGQTPLM 107
>ANKS3_HUMAN (Q6ZW76) Ankyrin repeat and SAM domain-containing protein 3| Length = 656 Score = 27.7 bits (60), Expect = 8.4 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 37 HMTIVVLLLYSTPELNVPTKKKKTPIL 117 H TIV LLL + +NVPT + +TP++ Sbjct: 81 HDTIVHLLLEAGVSVNVPTPEGQTPLM 107 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,475,471 Number of Sequences: 219361 Number of extensions: 624136 Number of successful extensions: 1756 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1727 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1756 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)