ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast13c05 |
|---|---|
| Clone Library Name | barley_pub |
>END8_ECOLI (P50465) Endonuclease VIII (DNA glycosylase/AP lyase Nei) (EC| 3.2.2.-) (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase Nei) Length = 262 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 18 RVAQYRSQYQENTVELHQSSDLRIMVPPHSLQHPLLPRSNAD 143 RV + + Q + T+ L+ +SD+ ++ P HP L R D Sbjct: 87 RVLRVKLQTADKTILLYSASDIEMLTPEQLTTHPFLQRVGPD 128
>END8_ECOL6 (Q8FJU5) Endonuclease VIII (DNA glycosylase/AP lyase Nei) (EC| 3.2.2.-) (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase Nei) Length = 262 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 18 RVAQYRSQYQENTVELHQSSDLRIMVPPHSLQHPLLPRSNAD 143 RV + + Q + T+ L+ +SD+ ++ P HP L R D Sbjct: 87 RVLRVKLQTADKTILLYSASDIEMLTPEQLTTHPFLQRVGPD 128
>END8_ECO57 (Q8X9C6) Endonuclease VIII (DNA glycosylase/AP lyase Nei) (EC| 3.2.2.-) (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase Nei) Length = 262 Score = 30.4 bits (67), Expect = 1.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 18 RVAQYRSQYQENTVELHQSSDLRIMVPPHSLQHPLLPRSNAD 143 RV + + Q + T+ L+ +SD+ ++ P HP L R D Sbjct: 87 RVLRVKLQTADKTILLYSASDIEMLTPEQLTTHPFLQRVGPD 128
>Y4EF_RHISN (P55429) Putative integrase/recombinase y4eF| Length = 251 Score = 30.0 bits (66), Expect = 2.2 Identities = 24/75 (32%), Positives = 33/75 (44%), Gaps = 3/75 (4%) Frame = +3 Query: 3 DNAGHRVAQYRSQYQENTVELHQSSDLRIMVPPHSLQHPL---LPRSNADSIARQHTQTP 173 D AGH + +Y + V+ H S L V PHSL+H L + AD +T Sbjct: 152 DRAGHPITRYA--VGQACVKPHDLSRLSKPVTPHSLRHAFVVHLLEAGAD------VRTI 203 Query: 174 LPHIAHGFIWTQQHY 218 P + H + T HY Sbjct: 204 QPLLGHRSLATTAHY 218
>YH17_YEAST (P38898) Hypothetical 17.1 kDa protein in PUR5 3'region| Length = 153 Score = 26.6 bits (57), Expect(2) = 3.4 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 1/39 (2%) Frame = +3 Query: 69 QSSDLRIMVP-PHSLQHPLLPRSNADSIARQHTQTPLPH 182 Q SD+ I P PH HP P HT TP PH Sbjct: 13 QYSDIYIHTPHPHPHPHPHTPTHT-----HPHTPTPTPH 46 Score = 21.6 bits (44), Expect(2) = 3.4 Identities = 7/10 (70%), Positives = 7/10 (70%) Frame = +1 Query: 169 HHCHTSHTVL 198 HH HT HT L Sbjct: 63 HHTHTPHTTL 72
>END8_SHIFL (Q83LZ7) Endonuclease VIII (DNA glycosylase/AP lyase Nei) (EC| 3.2.2.-) (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase Nei) Length = 262 Score = 29.3 bits (64), Expect = 3.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +3 Query: 18 RVAQYRSQYQENTVELHQSSDLRIMVPPHSLQHPLLPRSNAD 143 RV + + Q + T+ L+ +SD+ ++ P HP L R D Sbjct: 87 RVLRVKLQTADKTILLYSASDIEMLRPEQLTTHPFLQRVGPD 128
>END8_SALTY (Q8ZQU6) Endonuclease VIII (DNA glycosylase/AP lyase Nei) (EC| 3.2.2.-) (EC 4.2.99.18) (DNA-(apurinic or apyrimidinic site) lyase Nei) Length = 262 Score = 28.1 bits (61), Expect = 8.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 18 RVAQYRSQYQENTVELHQSSDLRIMVPPHSLQHPLLPRSNAD 143 R+ + R Q + T+ L+ +SD+ ++ HP L R D Sbjct: 87 RILRVRLQTADKTILLYSASDIEMLTAEQLTTHPFLQRVGPD 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,979,852 Number of Sequences: 219361 Number of extensions: 727759 Number of successful extensions: 2614 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2549 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2614 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
