| Clone Name | rbast12h09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HCDR_XANP2 (Q56840) 2-(R)-hydroxypropyl-CoM dehydrogenase (EC 1.... | 29 | 4.1 | 2 | HSP22_DROME (P02515) Heat shock protein 22 | 28 | 6.9 |
|---|
>HCDR_XANP2 (Q56840) 2-(R)-hydroxypropyl-CoM dehydrogenase (EC 1.1.1.268)| (R-HPCDH) (Aliphatic epoxide carboxylation component III) Length = 249 Score = 28.9 bits (63), Expect = 4.1 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = +3 Query: 27 RFTQAKLRSQLT*VVPQIELGFHGTLANAVQFEAG 131 R Q +LR Q+ +PQ E+G +A+AV F AG Sbjct: 195 RLDQPELRDQVLARIPQKEIGTAAQVADAVMFLAG 229
>HSP22_DROME (P02515) Heat shock protein 22| Length = 174 Score = 28.1 bits (61), Expect = 6.9 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 135 LPRLQTVPHSLMFHETPVQSVAPPRSTE-ISVW 40 +PRL + P FHE PV SVA PR+ + I+ W Sbjct: 17 MPRLSS-PFHAFFHEPPVWSVALPRNWQHIARW 48 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,526,133 Number of Sequences: 219361 Number of extensions: 319917 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 490 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 80,573,946 effective HSP length: 26 effective length of database: 74,870,560 effective search space used: 1796893440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)