>PFA4_CANAL (Q5AGV7) Palmitoyltransferase PFA4 (EC 2.3.1.-) (Protein fatty|
           acyltransferase 4)
          Length = 446

 Score = 28.1 bits (61), Expect = 5.9
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%)
 Frame = -1

Query: 204 FFRWLRWMIWKNKGSLYLLLMSLC---FQISNKTHSLRNKDKL 85
           F R+L W+IW   G L + L+ L    ++ SN  H L NK +L
Sbjct: 159 FMRFLGWIIW-GTGYLMIQLIKLIINYYENSNMPHYLFNKTEL 200


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 42,019,086
Number of Sequences: 219361
Number of extensions: 704906
Number of successful extensions: 1623
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1610
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1623
length of database: 80,573,946
effective HSP length: 78
effective length of database: 63,463,788
effective search space used: 1523130912
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)