| Clone Name | rbast10e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | R1_ARATH (Q9SAC6) Alpha-glucan water dikinase, chloroplast precu... | 30 | 1.8 | 2 | CAS4_EPHMU (P18503) Short-chain collagen C4 (Fragment) | 28 | 6.7 | 3 | PSY_NARPS (P53797) Phytoene synthase, chloroplast precursor (EC ... | 28 | 8.8 |
|---|
>R1_ARATH (Q9SAC6) Alpha-glucan water dikinase, chloroplast precursor (EC| 2.7.9.4) (Starch-related R1 protein) (Starch excess protein 1) Length = 1399 Score = 30.0 bits (66), Expect = 1.8 Identities = 15/43 (34%), Positives = 25/43 (58%), Gaps = 2/43 (4%) Frame = +3 Query: 3 ALSKERRQWTSSPPDLIIPGAAVL--VVDTRMLYTSTQLMFPL 125 ALS++ +W P D++ P + + VDT++ TST L P+ Sbjct: 397 ALSQKGGEWLDPPSDILPPNSLPVRGAVDTKLTITSTDLPSPV 439
>CAS4_EPHMU (P18503) Short-chain collagen C4 (Fragment)| Length = 366 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +1 Query: 88 ECYTPPPN*CSLCPXXXXXXXXXXGAVGAVAA 183 EC+ PPP C CP GA GA A Sbjct: 25 ECFYPPPPTCPTCPAGPPGAPGPQGAPGAPGA 56
>PSY_NARPS (P53797) Phytoene synthase, chloroplast precursor (EC 2.5.1.-)| Length = 423 Score = 27.7 bits (60), Expect = 8.8 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 12/65 (18%) Frame = +3 Query: 9 SKERRQWTSSPPDLIIPGAAVLVVD------------TRMLYTSTQLMFPLPKTTMPAAM 152 +K R+ T PD+++PG L+ D + Y T LM P + + A+ Sbjct: 103 TKSSRKSTDVKPDIVLPGTVYLLKDAYDRCGEVCAEYAKTFYLGTLLMTPERRRAI-WAI 161 Query: 153 TPWCR 167 WCR Sbjct: 162 YVWCR 166 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,648,703 Number of Sequences: 219361 Number of extensions: 416582 Number of successful extensions: 1427 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1405 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1426 length of database: 80,573,946 effective HSP length: 36 effective length of database: 72,676,950 effective search space used: 1744246800 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)