| Clone Name | rbast10c06 |
|---|---|
| Clone Library Name | barley_pub |
>BAR3_CHITE (Q03376) Balbiani ring protein 3 precursor| Length = 1700 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/61 (27%), Positives = 22/61 (36%) Frame = -3 Query: 264 CQIHGQPSQPRQGCTHATSPQDSRFIIIIMLGI*MECSSPPPLAYSPCFRNKKTCYHSCS 85 CQ P +P+ GCT A D +C + C NKK C +C Sbjct: 705 CQCDCVPGKPKGGCTGAQKWCDKT----------CKCKCEKEMPTGGCENNKKWCDETCD 754 Query: 84 C 82 C Sbjct: 755 C 755
>AXN_DROME (Q9V407) Axin (Axis inhibition protein) (dAxin) (d-Axin)| Length = 745 Score = 30.0 bits (66), Expect = 1.5 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +2 Query: 257 IWQEQHGHRSPSTRLPCASTCSLRR 331 +W++Q HRSP T PC S RR Sbjct: 508 VWKDQTPHRSPGTMSPCPPIPSRRR 532
>RL15_SULSO (Q9UX85) 50S ribosomal protein L15P| Length = 144 Score = 29.6 bits (65), Expect = 2.0 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 6/37 (16%) Frame = +2 Query: 242 EGWPWI------WQEQHGHRSPSTRLPCASTCSLRRL 334 E W W+ W +HG R+P+T+L S SLR+L Sbjct: 42 EKWSWLVKYGKGWYGKHGFRNPTTKL--TSAISLRKL 76
>METE_VIBPA (Q87NA1) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 760 Score = 29.3 bits (64), Expect = 2.5 Identities = 12/44 (27%), Positives = 22/44 (50%) Frame = -3 Query: 333 RRRREQVEAQGSRVEGDLCPCCSCQIHGQPSQPRQGCTHATSPQ 202 +++ +V G ++GD +C + QP + R+ TH PQ Sbjct: 353 KQKVTEVALLGRALDGDQNAILACDTYSQPIKARKTATHVNKPQ 396
>DIDO1_HUMAN (Q9BTC0) Death-inducer obliterator 1 (DIO-1) (Death-associated| transcription factor 1) (DATF-1) (hDido1) Length = 2240 Score = 28.9 bits (63), Expect = 3.3 Identities = 14/38 (36%), Positives = 20/38 (52%) Frame = -1 Query: 311 KRKAAEWKEICARAAPARSMANLHSLVKDVLMQPPPKT 198 KR+ E +E + A ++ H V D LM PPPK+ Sbjct: 1490 KRQLEEQEEALRQQRAAVGVSMAHFSVSDALMSPPPKS 1527
>CX1A_NAJAT (Q98957) Cardiotoxin 1a precursor| Length = 81 Score = 28.1 bits (61), Expect = 5.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 189 IIIIMLGI*MECSSPPPLAYSPCFRNKKTCY 97 I+ + LG ++C+ PP+A C K CY Sbjct: 13 IVCLDLGYTLKCNKLPPIASKTCPAGKNLCY 43
>YAV2_XANCV (P14728) Hypothetical 82 kDa avirulence protein in avrBs3 region| Length = 784 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 239 CEGWPWIWQEQHGHRSPSTRLPCA 310 C GW W W + PSTR CA Sbjct: 27 CAGWEWHW------KKPSTRTTCA 44
>METE_VIBVY (Q7MJM6) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 778 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 333 RRRREQVEAQGSRVEGDLCPCCSCQIHGQPSQPRQGCTH 217 +++ +V G ++GD C+ + QP Q R+ H Sbjct: 353 KQKVSEVVLLGKALDGDAASIAQCEAYSQPIQARKSAAH 391
>METE_VIBVU (Q8CWK1) 5-methyltetrahydropteroyltriglutamate--homocysteine| methyltransferase (EC 2.1.1.14) (Methionine synthase, vitamin-B12 independent isozyme) (Cobalamin-independent methionine synthase) Length = 778 Score = 27.7 bits (60), Expect = 7.4 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = -3 Query: 333 RRRREQVEAQGSRVEGDLCPCCSCQIHGQPSQPRQGCTH 217 +++ +V G ++GD C+ + QP Q R+ H Sbjct: 353 KQKVSEVVLLGKALDGDAAAIAQCEAYSQPIQARKSAAH 391
>RRPL_UUK (P33453) RNA-directed RNA polymerase (EC 2.7.7.48) (L protein)| Length = 2103 Score = 27.3 bits (59), Expect = 9.7 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 4 CMHVCLFRKP 33 CMHVCLF+KP Sbjct: 914 CMHVCLFKKP 923
>MVPB_DICDI (P54659) Major vault protein beta (MVP-beta)| Length = 846 Score = 27.3 bits (59), Expect = 9.7 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = -1 Query: 272 AAPARSMANLHSLVKDVLMQPPPKTLDSSSSSCLEYEWN 156 A A + N H D++ Q + D SS+ CL +E N Sbjct: 579 AVAASTFDNFHKHSSDIIQQAVFGSTDGSSNDCLYFETN 617
>SOX3_HUMAN (P41225) Transcription factor SOX-3| Length = 446 Score = 27.3 bits (59), Expect = 9.7 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = -1 Query: 278 ARAAPARSMANLHSLVKDVLMQPPPKTLDSSSSSCL 171 A AA A S+ + S+VK PPP S +CL Sbjct: 359 AAAAAAMSLGPMGSVVKSEPSSPPPAIASHSQRACL 394 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,374,772 Number of Sequences: 219361 Number of extensions: 1119783 Number of successful extensions: 2830 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2730 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2829 length of database: 80,573,946 effective HSP length: 87 effective length of database: 61,489,539 effective search space used: 1475748936 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)