| Clone Name | rbast10b03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PSA4_ORYSA (Q9LE92) Proteasome subunit alpha type 4 (EC 3.4.25.1... | 69 | 4e-12 | 2 | PSA4_PETHY (O82530) Proteasome subunit alpha type 4 (EC 3.4.25.1... | 40 | 0.002 | 3 | PSA4_SPIOL (P52427) Proteasome subunit alpha type 4 (EC 3.4.25.1... | 39 | 0.004 | 4 | PSA4_ARATH (O81148) Proteasome subunit alpha type 4 (EC 3.4.25.1... | 33 | 0.15 |
|---|
>PSA4_ORYSA (Q9LE92) Proteasome subunit alpha type 4 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit alpha-3) Length = 250 Score = 68.6 bits (166), Expect = 4e-12 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -2 Query: 242 VQPGTGEVQYQVCSPDAMGKLLAKAGLTQPAPEA 141 +QPGTGEVQYQVCSP+AMGKLLAKAGL+QPAPEA Sbjct: 217 LQPGTGEVQYQVCSPEAMGKLLAKAGLSQPAPEA 250
>PSA4_PETHY (O82530) Proteasome subunit alpha type 4 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit alpha-3) Length = 249 Score = 39.7 bits (91), Expect = 0.002 Identities = 15/28 (53%), Positives = 22/28 (78%) Frame = -2 Query: 227 GEVQYQVCSPDAMGKLLAKAGLTQPAPE 144 G+V+YQ CSP+ + +L K+GLTQP+ E Sbjct: 220 GKVKYQACSPEKLNSMLVKSGLTQPSAE 247
>PSA4_SPIOL (P52427) Proteasome subunit alpha type 4 (EC 3.4.25.1) (20S| proteasome alpha subunit C) (20S proteasome subunit alpha-3) (Proteasome 27 kDa subunit) Length = 250 Score = 38.9 bits (89), Expect = 0.004 Identities = 16/29 (55%), Positives = 25/29 (86%) Frame = -2 Query: 230 TGEVQYQVCSPDAMGKLLAKAGLTQPAPE 144 +G+V+YQV SP+++ +LL ++GLTQPA E Sbjct: 220 SGKVKYQVHSPESLNRLLTESGLTQPAAE 248
>PSA4_ARATH (O81148) Proteasome subunit alpha type 4 (EC 3.4.25.1) (Proteasome| subunit alpha type 3) (20S proteasome alpha subunit C-1) (Proteasome 27 kDa subunit) (Proteasome component 9) Length = 250 Score = 33.5 bits (75), Expect = 0.15 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -2 Query: 221 VQYQVCSPDAMGKLLAKAGLTQPAPE 144 V+Y V SP+++ KLL K G+TQPA E Sbjct: 223 VKYHVHSPESLTKLLVKHGVTQPAAE 248 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,462,799 Number of Sequences: 219361 Number of extensions: 534447 Number of successful extensions: 1626 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1563 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1625 length of database: 80,573,946 effective HSP length: 56 effective length of database: 68,289,730 effective search space used: 1638953520 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)