| Clone Name | rbast08g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURE_NITEU (Q82VS8) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-... | 29 | 3.8 | 2 | MATK_VIGMU (Q6PSB9) Maturase K (Intron maturase) | 28 | 4.9 | 3 | TRME_CHLTR (O84704) Probable tRNA modification GTPase trmE | 28 | 6.4 |
|---|
>MURE_NITEU (Q82VS8) UDP-N-acetylmuramoylalanyl-D-glutamate--2,| 6-diaminopimelate ligase (EC 6.3.2.13) (UDP-N-acetylmuramyl-tripeptide synthetase) (Meso-diaminopimelate-adding enzyme) (UDP-MurNAc-tripeptide synthetase) Length = 521 Score = 28.9 bits (63), Expect = 3.8 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = -3 Query: 111 HPPSCVLVVLLFLHSTLPGFASSKQIRKNQAGVL 10 H P + VL L TL G K+IRKNQA ++ Sbjct: 367 HTPDALNEVLTGLRETLAGTRIKKRIRKNQAKLI 400
>MATK_VIGMU (Q6PSB9) Maturase K (Intron maturase)| Length = 504 Score = 28.5 bits (62), Expect = 4.9 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 1/61 (1%) Frame = -1 Query: 215 KLAYLDRLHTI-LQYLIITELLQVGFGLVVVADVFFIHLLVCWLYYYSFIPHYQALLPAN 39 KL YL+ I + Y I E+L V + DV F HL+ + YYYS ++ +L P Sbjct: 137 KLIYLNHKSDIRIPYPIHLEIL-VQILRYSIKDVSFFHLIRLFFYYYS---NWNSLFPPK 192 Query: 38 K 36 K Sbjct: 193 K 193
>TRME_CHLTR (O84704) Probable tRNA modification GTPase trmE| Length = 444 Score = 28.1 bits (61), Expect = 6.4 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = +3 Query: 12 EPLPDFSLFVCWKQSLVMWNEGIIIQPTHKKVDEEYI 122 +PLP+F + K ++++WN+ I+ P +V + I Sbjct: 307 QPLPEFPTILYQKPTILLWNKCDIVSPPQIEVPFQQI 343 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 31,819,615 Number of Sequences: 219361 Number of extensions: 497973 Number of successful extensions: 1333 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1318 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1333 length of database: 80,573,946 effective HSP length: 50 effective length of database: 69,605,896 effective search space used: 1670541504 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)