| Clone Name | rbast08g02 |
|---|---|
| Clone Library Name | barley_pub |
>TCB1_RABIT (P06333) T-cell receptor beta chain ANA 11| Length = 319 Score = 30.8 bits (68), Expect = 0.90 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 5/38 (13%) Frame = +1 Query: 43 YMIHPDSRTRAHTHSLGEAHLQT-----VHTHTARTHL 141 Y++HP + HTH+ H+ +HTHT THL Sbjct: 55 YLLHPHTHVCTHTHTCTHTHIHASTHVCIHTHTF-THL 91
>WRN_MOUSE (O09053) Werner syndrome ATP-dependent helicase homolog (EC 3.6.1.-)| Length = 1401 Score = 30.8 bits (68), Expect = 0.90 Identities = 16/55 (29%), Positives = 27/55 (49%) Frame = +1 Query: 67 TRAHTHSLGEAHLQTVHTHTARTHLYRLVVHKASSSQGPRLSGITTVPARYSTPL 231 T H+ + A L T ++ RTH Y++ +S + P+ S + P S+PL Sbjct: 1052 TTQHSSNQNPAGLTTKQSNLERTHSYKVPEKVSSGTNIPKKSAVMPSPGTSSSPL 1106
>VG_DROME (Q26366) Protein vestigial| Length = 453 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 3/40 (7%) Frame = +1 Query: 61 SRTRAHTHSLGEAHLQT---VHTHTARTHLYRLVVHKASS 171 S R H HSL AH HTHT +T L+V ++ + Sbjct: 152 SSHRTHAHSLAHAHTHPHSHTHTHTHQTKEEDLIVPRSEA 191
>QUEF_AQUAE (O67073) 7-cyano-7-deazaguanine reductase (EC 1.7.1.-)| Length = 129 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 114 YRLEMRFPERVCVCPCSG 61 Y +E+ FPE C+CP SG Sbjct: 30 YMIEITFPEFTCLCPRSG 47
>LAMC1_MOUSE (P02468) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1607 Score = 28.1 bits (61), Expect = 5.8 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 151 PNDRDVCVLCVCVPSGDALPRESVCVPVFG 62 PN D C C C P G + ++S C PV G Sbjct: 873 PNPADKCKACACNPYG-TVQQQSSCNPVTG 901
>MYOTI_HUMAN (Q9UBF9) Myotilin (Titin immunoglobulin domain protein)| (Myofibrillar titin-like Ig domains protein) (57 kDa cytoskeletal protein) Length = 498 Score = 27.7 bits (60), Expect = 7.6 Identities = 21/94 (22%), Positives = 40/94 (42%), Gaps = 6/94 (6%) Frame = +2 Query: 29 HLTLDT*SIPIPEHGHTHTLSGKRISRRYTHTQHAHISIV------WSYTKLAALKDRAC 190 H+T+ + + P H + G+R++ Y + + +S + ++ +K+ + D Sbjct: 61 HITMSSSAFPASPQQHAGSNPGQRVTTTYNQSPASFLSSILPSQPDYNSSKIPSAMDSNY 120 Query: 191 QALPQYQRGTPLH*YTKPQSTVLRSSYTRTYAHE 292 Q Q G P++ KP T RT HE Sbjct: 121 Q---QSSAGQPIN--AKPSQTANAKPIPRTPDHE 149
>ASPM_HYLLA (P62290) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 27.7 bits (60), Expect = 7.6 Identities = 13/40 (32%), Positives = 22/40 (55%) Frame = +2 Query: 98 RISRRYTHTQHAHISIVWSYTKLAALKDRACQALPQYQRG 217 +I + Y H + +SI + KLAA++ +A + Y RG Sbjct: 2639 KIRKHYLHLRATVVSIQRRHRKLAAVRTQAVICIQSYYRG 2678
>MDHP_PEA (P21528) Malate dehydrogenase [NADP], chloroplast precursor (EC| 1.1.1.82) (NADP-MDH) Length = 441 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/23 (65%), Positives = 15/23 (65%), Gaps = 3/23 (13%) Frame = +3 Query: 171 LSRT---ALVRHYHSTSAVLHST 230 LSRT L RHYHST A LH T Sbjct: 24 LSRTRTRTLPRHYHSTFAPLHRT 46
>LAMC1_HUMAN (P11047) Laminin gamma-1 chain precursor (Laminin B2 chain)| Length = 1609 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/30 (43%), Positives = 16/30 (53%) Frame = -1 Query: 151 PNDRDVCVLCVCVPSGDALPRESVCVPVFG 62 PN D C C C P G + ++S C PV G Sbjct: 875 PNPADKCKACNCNPYG-TMKQQSSCNPVTG 903
>PCSK5_MOUSE (Q04592) Proprotein convertase subtilisin/kexin type 5 precursor (EC| 3.4.21.-) (Proprotein convertase PC5) (Subtilisin/kexin-like protease PC5) (PC6) (Subtilisin-like proprotein convertase 6) (SPC6) Length = 1877 Score = 27.3 bits (59), Expect = 9.9 Identities = 19/61 (31%), Positives = 24/61 (39%), Gaps = 5/61 (8%) Frame = -1 Query: 202 W*CLTSAVLESC*L-CVRPNDRDVCVLCVCVPSGDALPRES----VCVPVFGNRDGSCIK 38 W +TS E C CV + D+C C+ P L E C F +DG C Sbjct: 1247 WPSVTSGSCEKCSEDCVSCSGADLCQQCLSQPDNTLLLHEGRCYHSCPEGFYAKDGVCEH 1306 Query: 37 C 35 C Sbjct: 1307 C 1307 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 46,828,162 Number of Sequences: 219361 Number of extensions: 925155 Number of successful extensions: 2359 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2358 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)