| Clone Name | rbast08f03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HYD_DROME (P51592) Ubiquitin--protein ligase hyd (EC 6.3.2.-) (P... | 29 | 3.9 | 2 | EDD1_RAT (Q62671) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (Hy... | 28 | 6.7 | 3 | EDD1_MOUSE (Q80TP3) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (... | 28 | 6.7 | 4 | EDD1_HUMAN (O95071) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (... | 28 | 6.7 |
|---|
>HYD_DROME (P51592) Ubiquitin--protein ligase hyd (EC 6.3.2.-) (Protein| hyperplastic discs) Length = 2885 Score = 28.9 bits (63), Expect = 3.9 Identities = 17/48 (35%), Positives = 30/48 (62%) Frame = +2 Query: 32 ASKLGLQPLVSITIR*KQEYKISSSHYILSFIHI*IYSPGVQDKSLLQ 175 AS+ G QPL S+TIR + + +++ +S ++I +YS KS+L+ Sbjct: 2827 ASEEGFQPLPSVTIRPADDSHLPTANTCISRLYIPLYS----SKSILR 2870
>EDD1_RAT (Q62671) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (Hyperplastic| discs protein homolog) (100 kDa protein) (Fragment) Length = 920 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 32 ASKLGLQPLVSITIR*KQEYKISSSHYILSFIHI*IYS 145 AS+ G QP+ SITIR + + +++ +S +++ +YS Sbjct: 862 ASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYS 899
>EDD1_MOUSE (Q80TP3) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (Hyperplastic| discs protein homolog) Length = 2792 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 32 ASKLGLQPLVSITIR*KQEYKISSSHYILSFIHI*IYS 145 AS+ G QP+ SITIR + + +++ +S +++ +YS Sbjct: 2734 ASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYS 2771
>EDD1_HUMAN (O95071) Ubiquitin-protein ligase EDD1 (EC 6.3.2.-) (Hyperplastic| discs protein homolog) (hHYD) (Progestin-induced protein) Length = 2799 Score = 28.1 bits (61), Expect = 6.7 Identities = 13/38 (34%), Positives = 25/38 (65%) Frame = +2 Query: 32 ASKLGLQPLVSITIR*KQEYKISSSHYILSFIHI*IYS 145 AS+ G QP+ SITIR + + +++ +S +++ +YS Sbjct: 2741 ASEEGFQPMPSITIRPPDDQHLPTANTCISRLYVPLYS 2778 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,788,615 Number of Sequences: 219361 Number of extensions: 398428 Number of successful extensions: 659 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 655 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 659 length of database: 80,573,946 effective HSP length: 37 effective length of database: 72,457,589 effective search space used: 1738982136 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)