| Clone Name | rbast08e09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YKD1_CAEEL (Q03560) Hypothetical protein B0464.2 in chromosome III | 28 | 5.0 | 2 | Y2195_VIBPA (Q87MN6) UPF0209 protein VP2195 | 28 | 6.6 | 3 | RLX3_STAAU (P14491) Protein rlx | 28 | 8.6 |
|---|
>YKD1_CAEEL (Q03560) Hypothetical protein B0464.2 in chromosome III| Length = 1150 Score = 28.5 bits (62), Expect = 5.0 Identities = 16/56 (28%), Positives = 27/56 (48%), Gaps = 7/56 (12%) Frame = +2 Query: 38 ISNIGVLQQSRRTVLKSEHHRTRKWDRFDQDTTSRSTPL-------PLYSHLLCLK 184 ++N+G L S + K+EHH R +R ++ + L P SHLL ++ Sbjct: 474 LNNVGALYMSMKQYEKAEHHFKRAKERLEEQLNTDEGSLLLERRSAPEKSHLLTIR 529
>Y2195_VIBPA (Q87MN6) UPF0209 protein VP2195| Length = 672 Score = 28.1 bits (61), Expect = 6.6 Identities = 11/32 (34%), Positives = 20/32 (62%) Frame = +2 Query: 32 IHISNIGVLQQSRRTVLKSEHHRTRKWDRFDQ 127 ++ SN+ L+++R LK ++H +W FDQ Sbjct: 25 VYFSNVNGLEETRYVFLK-QNHLPERWQEFDQ 55
>RLX3_STAAU (P14491) Protein rlx| Length = 330 Score = 27.7 bits (60), Expect = 8.6 Identities = 10/26 (38%), Positives = 18/26 (69%) Frame = +2 Query: 56 LQQSRRTVLKSEHHRTRKWDRFDQDT 133 L+Q+RR +K + R ++W RF++ T Sbjct: 249 LEQARREKIKRDKEREKEWARFNRST 274 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 27,442,261 Number of Sequences: 219361 Number of extensions: 422794 Number of successful extensions: 1192 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1192 length of database: 80,573,946 effective HSP length: 42 effective length of database: 71,360,784 effective search space used: 1712658816 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)