| Clone Name | rbast07f08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRFE_PAROL (O93429) Serotransferrin precursor | 28 | 6.4 | 2 | RBF1_CANAL (Q00312) Transcription factor RBF1 (RPG-box-binding f... | 28 | 8.4 | 3 | POLG_BOVEV (P12915) Genome polyprotein [Contains: Coat protein V... | 28 | 8.4 |
|---|
>TRFE_PAROL (O93429) Serotransferrin precursor| Length = 685 Score = 28.1 bits (61), Expect = 6.4 Identities = 19/57 (33%), Positives = 28/57 (49%) Frame = +3 Query: 12 LICSLQPNDSVRDIIT**IKINLSRRRHHKAVVAQKQRVHTMMATFLKQQSSLFGNS 182 LIC + SV + ++ NL++ H V + + T + TFL Q S FGNS Sbjct: 564 LICPSKGPVSVENFMS----CNLAKVNAHAVVT--RPEIRTKVVTFLNNQQSHFGNS 614
>RBF1_CANAL (Q00312) Transcription factor RBF1 (RPG-box-binding factor)| (Repressor-activator protein 1) Length = 527 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/31 (32%), Positives = 15/31 (48%) Frame = +2 Query: 44 PRHHHMIDKNQSVQTQAPQSCSGTEAKSTHN 136 P HHH++ + Q Q Q Q + + HN Sbjct: 325 PHHHHLLQQEQQQQQQQQQQQQQQQQQQQHN 355
>POLG_BOVEV (P12915) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2174 Score = 27.7 bits (60), Expect = 8.4 Identities = 14/48 (29%), Positives = 24/48 (50%) Frame = +2 Query: 35 RFCPRHHHMIDKNQSVQTQAPQSCSGTEAKSTHNDGNLSKTTV*SFWK 178 + C HH +DK+ V P CSGT ++ + + +T V + +K Sbjct: 1980 QLCCSHHLYMDKHYYVVGGMPSGCSGTSIFNSMINNLIIRTLVLTVYK 2027 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,324,813 Number of Sequences: 219361 Number of extensions: 600074 Number of successful extensions: 1650 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1610 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1650 length of database: 80,573,946 effective HSP length: 49 effective length of database: 69,825,257 effective search space used: 1675806168 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)