ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast07e04 |
|---|---|
| Clone Library Name | barley_pub |
>IFB2_CAEEL (Q19286) Intermediate filament protein ifb-2 (Intermediate filament| protein B2) (IF-B2) (Cel IF B2) Length = 543 Score = 30.8 bits (68), Expect = 0.90 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -1 Query: 299 SGAYSGARGVEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSW 171 S A+SG GVE V RLR DL H E +R R ++W Sbjct: 101 SEAHSGTIGVEVKVDRLRDDLNDYRH-RYEEARREVEREKTTW 142
>VL1_HPV11 (P04012) Major capsid protein L1| Length = 501 Score = 29.3 bits (64), Expect = 2.6 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +E+T R +++ TC PT + K+ + S WE + +D PLG K Sbjct: 410 LEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRK 463
>VL1_HPV35 (P27232) Major capsid protein L1| Length = 502 Score = 29.3 bits (64), Expect = 2.6 Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +E+T R + + TC P+ P+ K ++ + WE + +D PLG K Sbjct: 412 LEDTYRYVTSQAVTCQKPSAPKPKDDPLKNYTFWEVDLKEKFSADLDQFPLGRK 465
>MASZ_SHIFL (P59663) Malate synthase G (EC 2.3.3.9)| Length = 722 Score = 28.5 bits (62), Expect = 4.5 Identities = 12/30 (40%), Positives = 20/30 (66%), Gaps = 1/30 (3%) Frame = +3 Query: 51 TLHILHYYYVNMSRLR-SICAADSSSSFEP 137 TLH LHY++ N+ ++ +I + S+ FEP Sbjct: 541 TLHALHYHHTNVQSVQANIAQTEFSAEFEP 570
>VL1_HPV6B (P69899) Major capsid protein L1| Length = 500 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +E+T R +++ TC PT + K ++ S WE + +D PLG K Sbjct: 409 LEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRK 462
>VL1_HPV6A (P69898) Major capsid protein L1| Length = 500 Score = 28.5 bits (62), Expect = 4.5 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +E+T R +++ TC PT + K ++ S WE + +D PLG K Sbjct: 409 LEDTYRYVQSQAITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRK 462
>ZC3H5_MOUSE (Q8BL48) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 30 LFAKKKITLH----ILHYYYVNMSRLRSICAADSSSSFEPE 140 LF + K T H H+++VN R RSI D + ++ P+ Sbjct: 47 LFVQHKCTQHRPYTCFHWHFVNQRRRRSIRRRDGTFNYSPD 87
>ZC3H5_HUMAN (Q9C0B0) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 30 LFAKKKITLH----ILHYYYVNMSRLRSICAADSSSSFEPE 140 LF + K T H H+++VN R RSI D + ++ P+ Sbjct: 47 LFVQHKCTQHRPYTCFHWHFVNQRRRRSIRRRDGTFNYSPD 87
>ZC3H5_CANFA (Q6EE22) Zinc finger CCCH-type domain-containing protein 5| Length = 810 Score = 28.5 bits (62), Expect = 4.5 Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 4/41 (9%) Frame = +3 Query: 30 LFAKKKITLH----ILHYYYVNMSRLRSICAADSSSSFEPE 140 LF + K T H H+++VN R RSI D + ++ P+ Sbjct: 47 LFVQHKCTQHRPYTCFHWHFVNQRRRRSIRRRDGTFNYSPD 87
>VL1_HPV2A (P25486) Major capsid protein L1| Length = 510 Score = 28.1 bits (61), Expect = 5.8 Identities = 15/54 (27%), Positives = 25/54 (46%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +++T R L++ TC PT P+ S + W+ + +D PLG K Sbjct: 424 LQDTYRYLQSQAITCQKPTPPKTPTDPYASLTFWDVDLSESFSMDLDQFPLGRK 477
>VL1_HPV13 (Q02273) Major capsid protein L1| Length = 499 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +E+T R +++ TC PT + K+ S WE + +D PLG K Sbjct: 409 LEDTYRYVQSQAITCQKPTPDKEKQDPYAGLSFWEVNLKEKFSSELDQYPLGRK 462
>VL1_PCPV1 (Q02274) Major capsid protein L1| Length = 502 Score = 28.1 bits (61), Expect = 5.8 Identities = 16/54 (29%), Positives = 25/54 (46%), Gaps = 6/54 (11%) Frame = -1 Query: 272 VEETVRRLRADLPTCHHPTVPEVKRSTRRSTSSWE------YICSIDLSPLGLK 129 +E+T R +++ TC PT + K+ S WE + +D PLG K Sbjct: 412 LEDTYRYVQSQAITCQKPTPDKEKQDPYAGLSFWEVNLKEKFSSELDQYPLGRK 465
>TRPV6_HUMAN (Q9H1D0) Transient receptor potential cation channel subfamily V| member 6 (TrpV6) (Epithelial calcium channel 2) (ECaC2) (Calcium transport protein 1) (CaT1) (CaT-like) (CaT-L) Length = 725 Score = 27.3 bits (59), Expect = 9.9 Identities = 13/36 (36%), Positives = 22/36 (61%), Gaps = 2/36 (5%) Frame = -1 Query: 269 EETVRRLRADLPTCHHPTVP--EVKRSTRRSTSSWE 168 +++V +L P H ++P V RST RS+++WE Sbjct: 661 KDSVEKLELGCPFSPHLSLPMPSVSRSTSRSSANWE 696
>ISPD_VIBCH (Q9KUJ2) 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase| (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT) Length = 232 Score = 27.3 bits (59), Expect = 9.9 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 3/37 (8%) Frame = -1 Query: 245 ADLPTCHHPTVPEVKRSTRRS---TSSWEYICSIDLS 144 A+LP HHP V V R+ S+ EY+C LS Sbjct: 62 ANLPLAHHPRVIRVDGGKERADSVLSALEYVCQHRLS 98
>RFBD_SALTY (P26392) dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)| (dTDP-4-keto-L-rhamnose reductase) (dTDP-6-deoxy-L-mannose dehydrogenase) (dTDP-L-rhamnose synthetase) Length = 299 Score = 27.3 bits (59), Expect = 9.9 Identities = 12/26 (46%), Positives = 17/26 (65%) Frame = -1 Query: 314 HVGQRSGAYSGARGVEETVRRLRADL 237 H + G +S +GV ETVR+LR D+ Sbjct: 32 HSKEFCGDFSNPKGVAETVRKLRPDV 57 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,115,149 Number of Sequences: 219361 Number of extensions: 756290 Number of successful extensions: 2002 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 1970 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2002 length of database: 80,573,946 effective HSP length: 80 effective length of database: 63,025,066 effective search space used: 1512601584 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
