| Clone Name | rbast07d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIN1_HUMAN (Q13671) Ras and Rab interactor 1 (Ras interaction/in... | 28 | 5.5 | 2 | NBEA_CAEEL (Q19317) Putative neurobeachin homolog | 28 | 7.2 |
|---|
>RIN1_HUMAN (Q13671) Ras and Rab interactor 1 (Ras interaction/interference| protein 1) (Ras inhibitor JC99) Length = 783 Score = 28.5 bits (62), Expect = 5.5 Identities = 10/30 (33%), Positives = 21/30 (70%) Frame = +3 Query: 24 FMFYRGFDWPDMTGSGTDILGNGQAKNQNR 113 ++ YR +WP+ G+ T+ G+GQ++ ++R Sbjct: 698 YLVYRRAEWPETQGAVTEEEGSGQSEARSR 727
>NBEA_CAEEL (Q19317) Putative neurobeachin homolog| Length = 2507 Score = 28.1 bits (61), Expect = 7.2 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 102 FLLVHFQVCPSQILSCQANQTLD 34 F+L+H Q S ++SCQ NQ +D Sbjct: 2020 FVLMHRQALESDLVSCQLNQWID 2042 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 18,410,515 Number of Sequences: 219361 Number of extensions: 212689 Number of successful extensions: 974 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 973 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 974 length of database: 80,573,946 effective HSP length: 13 effective length of database: 77,722,253 effective search space used: 1865334072 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)