| Clone Name | rbast07a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y1R1_DROME (P16424) Hypothetical 50 kDa protein in type I retrot... | 29 | 3.6 | 2 | PRKDC_HUMAN (P78527) DNA-dependent protein kinase catalytic subu... | 29 | 3.6 |
|---|
>Y1R1_DROME (P16424) Hypothetical 50 kDa protein in type I retrotransposable| element R1DM (ORF 1) Length = 471 Score = 28.9 bits (63), Expect = 3.6 Identities = 12/40 (30%), Positives = 17/40 (42%) Frame = +1 Query: 142 CIHSEHSSPRCKLLERITLQALLQGHLRRSCGPPWGLRHC 261 C+ +H C+ E + Q QGH C P R+C Sbjct: 402 CVGFDHKVSECRQKESVCRQCGQQGHTAAKCQNPVDCRNC 441
>PRKDC_HUMAN (P78527) DNA-dependent protein kinase catalytic subunit (EC 2.7.11.1)| (DNA-PK catalytic subunit) (DNA-PKcs) (DNPK1) (p460) Length = 4128 Score = 28.9 bits (63), Expect = 3.6 Identities = 25/70 (35%), Positives = 35/70 (50%), Gaps = 2/70 (2%) Frame = -2 Query: 236 PQERRKCPCSS--ACKVILSSSLHRGLLCSE*MHQYQGQSQ*SFNLLFSNACLSSLF*SK 63 P + R+C S +CK + S GLL E + G + +LL + A LS+ Sbjct: 1493 PGDERQCLPSLDLSCKQLAS-----GLL--ELAFAFGGLCERLVSLLLNPAVLSTASLGS 1545 Query: 62 EKGSVIHFSH 33 +GSVIHFSH Sbjct: 1546 SQGSVIHFSH 1555 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 38,864,835 Number of Sequences: 219361 Number of extensions: 690066 Number of successful extensions: 1406 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1387 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1406 length of database: 80,573,946 effective HSP length: 64 effective length of database: 66,534,842 effective search space used: 1596836208 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)