ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbast06g06 |
|---|---|
| Clone Library Name | barley_pub |
>SAHH_TOBAC (P68173) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Cytokinin-binding protein CBP57) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_PHASS (P50249) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_PETCR (Q01781) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_NICSY (P68172) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Cytokinin-binding protein CBP57) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_MESCR (P93253) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_MEDSA (P50246) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_LYCES (Q9SWF5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 472 VPVEGPYKPAHYRY 485
>SAHH_RHOBA (Q7TTZ5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 448 Score = 31.2 bits (69), Expect = 0.71 Identities = 11/14 (78%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP+ YRY Sbjct: 435 VPVEGPYKPNHYRY 448
>SAHH_CATRO (P35007) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 30.8 bits (68), Expect = 0.93 Identities = 10/14 (71%), Positives = 13/14 (92%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +P+EGPYKP+ YRY Sbjct: 472 VPIEGPYKPAHYRY 485
>SAHH_CHLTE (Q8KEG8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 471 Score = 30.8 bits (68), Expect = 0.93 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP YRY Sbjct: 458 VPVEGPYKPEHYRY 471
>OSA_DROME (Q8IN94) Trithorax group protein osa (Protein eyelid)| Length = 2716 Score = 30.8 bits (68), Expect = 0.93 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = +2 Query: 35 KQTPPPSTNPNRSKNVTMTNPPP 103 +QTPPP+ PN+ N T PPP Sbjct: 594 QQTPPPAPPPNQGMNNMATPPPP 616
>SAHH_SYNPX (Q7U9Y3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 30.8 bits (68), Expect = 0.93 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP YRY Sbjct: 463 VPVEGPYKPDHYRY 476
>SAHH_PROMM (Q7V926) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 30.8 bits (68), Expect = 0.93 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP YRY Sbjct: 463 VPVEGPYKPDHYRY 476
>SAHH2_ARATH (Q9LK36) Adenosylhomocysteinase 2 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 1) (SAH hydrolase 2) (AdoHcyase 2) Length = 485 Score = 30.4 bits (67), Expect = 1.2 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 IPVEGPYKP YRY Sbjct: 472 IPVEGPYKPVHYRY 485
>SAHH1_ARATH (O23255) Adenosylhomocysteinase 1 (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase 1) (SAH hydrolase 1) (AdoHcyase 1) (HOMOLOGY-DEPENDENT GENE SILENCING 1 protein) Length = 485 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 IP+EGPYKP YRY Sbjct: 472 IPIEGPYKPPHYRY 485
>SAHH_ANOGA (O76757) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 432 Score = 30.4 bits (67), Expect = 1.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP YRY Sbjct: 419 LPVEGPYKPEHYRY 432
>DLG7_HUMAN (Q15398) Discs large homolog 7 (Hepatoma up-regulated protein)| (HURP) Length = 846 Score = 30.4 bits (67), Expect = 1.2 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = +2 Query: 8 NNNAIISGQKQTPPPSTNPNRSKNVTMTNPPPKRQHAQI*IDNAKENRIVHTSPRQSSRR 187 N NA+ + K+ P S RSK K Q Q IDN + R + PRQ+S + Sbjct: 134 NQNAVKAEPKKAIPSSVRITRSK--------AKDQMEQTKIDNESDVRAIRPGPRQTSEK 185
>SAHH_LUPLU (Q9SP37) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 485 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYKP YRY Sbjct: 472 VPVEGPYKPFHYRY 485
>SAHH_TRIVA (P51540) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 486 Score = 30.0 bits (66), Expect = 1.6 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGPYK AYRY Sbjct: 473 VPVEGPYKSDAYRY 486
>SAHH_BORPE (Q7VUL8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGP+KP YRY Sbjct: 459 VPVEGPFKPDHYRY 472
>SAHH_BORPA (Q7W1Z7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGP+KP YRY Sbjct: 459 VPVEGPFKPGHYRY 472
>SAHH_BORBR (Q7WQX5) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 29.3 bits (64), Expect = 2.7 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PVEGP+KP YRY Sbjct: 459 VPVEGPFKPGHYRY 472
>PDZK3_RAT (Q9QZR8) PDZ domain-containing protein 3 (PDZ domain-containing| protein 2) (Plakophilin-related armadillo repeat protein-interacting PDZ protein) Length = 2766 Score = 29.3 bits (64), Expect = 2.7 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +1 Query: 31 AKANATSVN--QP*PV*KRNHDKSST*ETTCPDLDR*CKGKQDSSYVAEAEFPSVRLLRL 204 +K N +SV QP PV + + T + PDLD+ C G+ DS+ F + L + Sbjct: 2372 SKRNKSSVRHAQPSPVSRSKLQERRT--LSMPDLDKLCNGEDDSASPGAVLFKT--QLEI 2427 Query: 205 SPAASRAGVDALVPVG 252 +P S+ G A P G Sbjct: 2428 TPRRSK-GSQATSPAG 2442
>P2RY2_HUMAN (P41231) P2Y purinoceptor 2 (P2Y2) (P2U purinoceptor 1) (P2U1) (ATP| receptor) (Purinergic receptor) Length = 377 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/23 (60%), Positives = 15/23 (65%) Frame = -1 Query: 251 PTGTSASTPARLAAGLSLSRRTD 183 PTG S +TPAR GL S RTD Sbjct: 323 PTGPSPATPARRRLGLRRSDRTD 345
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 28.9 bits (63), Expect = 3.5 Identities = 14/43 (32%), Positives = 20/43 (46%) Frame = +2 Query: 89 TNPPPKRQHAQI*IDNAKENRIVHTSPRQSSRRCACSGSAQPL 217 TNP Q N N+ +T+P Q+ +RC+C PL Sbjct: 283 TNPCQSAVQNQGQNSNPNPNQNPNTNPNQNQQRCSCQPQTSPL 325
>SAHH_CAEEL (P27604) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Protein dumpy-14) Length = 437 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +PV GPYKP YRY Sbjct: 424 VPVAGPYKPDHYRY 437
>SAHH_METCA (Q60CG8) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +P EGPYKP YRY Sbjct: 459 VPKEGPYKPDHYRY 472
>ANK1_MOUSE (Q02357) Ankyrin-1 (Erythrocyte ankyrin)| Length = 1862 Score = 28.5 bits (62), Expect = 4.6 Identities = 24/72 (33%), Positives = 34/72 (47%), Gaps = 15/72 (20%) Frame = -1 Query: 281 SQLRVPTSRLPTGTSAS-------TPARLAA--------GLSLSRRTDGNSASATYELSC 147 +Q+ V S L G SA+ TP LAA L LS++ +GN + + Sbjct: 609 NQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKS---GL 665 Query: 146 FPLHYLSRSGHV 111 PLH +S+ GHV Sbjct: 666 TPLHLVSQEGHV 677
>SAHH_PSESM (Q87V73) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 469 Score = 28.5 bits (62), Expect = 4.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 + VEGP+KP AYRY Sbjct: 456 VTVEGPFKPDAYRY 469
>SAHH_PROMP (Q7UZN3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 472 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 + VEGPYKP YRY Sbjct: 459 VSVEGPYKPEQYRY 472
>TRPA1_DROME (Q7Z020) Transient receptor potential cation channel subfamily A| member 1 (Ankyrin-like with transmembrane domains protein 1) (dANKTM1) Length = 1197 Score = 28.1 bits (61), Expect = 6.0 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 155 LSCFPLHYLSRSGHVVS 105 + C PLHY SR GH+ S Sbjct: 443 MGCSPLHYASRDGHIRS 459
>SAHH_STRFR (P26799) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) (Fragment) Length = 120 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 + VEGPYKP YRY Sbjct: 107 VEVEGPYKPDHYRY 120
>P60_LISMO (P21171) Protein p60 precursor (Invasion-associated protein)| Length = 484 Score = 27.7 bits (60), Expect = 7.9 Identities = 22/79 (27%), Positives = 29/79 (36%), Gaps = 11/79 (13%) Frame = +2 Query: 35 KQTPPPSTNPNRSK-----------NVTMTNPPPKRQHAQI*IDNAKENRIVHTSPRQSS 181 K P PSTN N +K N T TN P K + N N +T+ Q S Sbjct: 304 KPAPAPSTNTNANKTNTNTNTNTNTNNTNTNTPSKNTNTN---SNTNTNTNSNTNANQGS 360 Query: 182 RRCACSGSAQPLVVLEWTH 238 + SA ++ H Sbjct: 361 SNNNSNSSASAIIAEAQKH 379
>SAHH_NOCFA (Q5YQS7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 + VEGPYKP YRY Sbjct: 481 VDVEGPYKPEHYRY 494
>SAHH_MYCTU (P60176) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 + VEGPYKP YRY Sbjct: 481 VDVEGPYKPDHYRY 494
>SAHH_MYCBO (Q7TWW7) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 494 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 + VEGPYKP YRY Sbjct: 481 VDVEGPYKPDHYRY 494
>SAHH_PROMA (Q7V9P3) Adenosylhomocysteinase (EC 3.3.1.1)| (S-adenosyl-L-homocysteine hydrolase) (AdoHcyase) Length = 476 Score = 27.7 bits (60), Expect = 7.9 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -3 Query: 282 IPVEGPYKPSAYRY 241 +P+EGPYK YRY Sbjct: 463 VPIEGPYKSEQYRY 476
>OTX2_MOUSE (P80206) Homeobox protein OTX2| Length = 289 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -1 Query: 284 ASQLRVPTSR-LPTGTSASTPARLAAGLSLSRRTDGNSASATYELSCFPLHYLSRSGH 114 + Q P+S +PT S+S P + + S+S +D S S++ +P+ Y SG+ Sbjct: 128 SGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGY 185
>OTX2_HUMAN (P32243) Homeobox protein OTX2| Length = 289 Score = 27.7 bits (60), Expect = 7.9 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = -1 Query: 284 ASQLRVPTSR-LPTGTSASTPARLAAGLSLSRRTDGNSASATYELSCFPLHYLSRSGH 114 + Q P+S +PT S+S P + + S+S +D S S++ +P+ Y SG+ Sbjct: 128 SGQFTPPSSTSVPTIASSSAPVSIWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGY 185 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,768,946 Number of Sequences: 219361 Number of extensions: 742388 Number of successful extensions: 2627 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 2424 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2613 length of database: 80,573,946 effective HSP length: 70 effective length of database: 65,218,676 effective search space used: 1565248224 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
